Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WDJ7

Protein Details
Accession K5WDJ7    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-51HEATDPPKQHSRRRPQRPKKNGQSTGPSDHydrophilic
58-80SSSNGPNTNRRRNPNKPRPAPTPHydrophilic
NLS Segment(s)
PositionSequence
32-42HSRRRPQRPKK
104-108GRRAK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT135056  -  
Amino Acid Sequences HEVGAANLDSQPAAIASDNSGPHEATDPPKQHSRRRPQRPKKNGQSTGPSDALPAEHSSSNGPNTNRRRNPNKPRPAPTPETDNQVAPDLIQGAIQPGKPNGGGRRAKFRGKLTENDGPSNPSISSNPSKKYRSKATEPLDDLTSRLIRELSSPPYPDCPHLFLFCLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.14
5 0.14
6 0.16
7 0.18
8 0.16
9 0.16
10 0.18
11 0.19
12 0.19
13 0.27
14 0.28
15 0.32
16 0.41
17 0.46
18 0.53
19 0.61
20 0.68
21 0.7
22 0.79
23 0.86
24 0.88
25 0.93
26 0.95
27 0.95
28 0.95
29 0.95
30 0.91
31 0.85
32 0.83
33 0.77
34 0.72
35 0.62
36 0.5
37 0.4
38 0.32
39 0.27
40 0.19
41 0.15
42 0.11
43 0.1
44 0.11
45 0.12
46 0.14
47 0.16
48 0.19
49 0.19
50 0.26
51 0.34
52 0.44
53 0.49
54 0.55
55 0.62
56 0.68
57 0.78
58 0.8
59 0.83
60 0.81
61 0.8
62 0.79
63 0.77
64 0.71
65 0.62
66 0.59
67 0.49
68 0.46
69 0.41
70 0.34
71 0.28
72 0.24
73 0.21
74 0.13
75 0.12
76 0.07
77 0.06
78 0.06
79 0.05
80 0.05
81 0.07
82 0.07
83 0.08
84 0.08
85 0.09
86 0.09
87 0.12
88 0.14
89 0.22
90 0.27
91 0.28
92 0.38
93 0.42
94 0.46
95 0.49
96 0.51
97 0.51
98 0.5
99 0.53
100 0.5
101 0.53
102 0.5
103 0.48
104 0.44
105 0.36
106 0.33
107 0.3
108 0.23
109 0.17
110 0.16
111 0.18
112 0.26
113 0.28
114 0.34
115 0.4
116 0.45
117 0.49
118 0.56
119 0.61
120 0.61
121 0.64
122 0.68
123 0.67
124 0.71
125 0.68
126 0.63
127 0.56
128 0.48
129 0.4
130 0.35
131 0.3
132 0.21
133 0.18
134 0.16
135 0.13
136 0.17
137 0.21
138 0.23
139 0.26
140 0.29
141 0.3
142 0.37
143 0.39
144 0.4
145 0.39
146 0.38
147 0.36
148 0.36