Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WT34

Protein Details
Accession K5WT34    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
131-150IEYFKKHPSRSAKNNRLHLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027434  Homing_endonucl  
IPR004860  LAGLIDADG_2  
Gene Ontology GO:0004519  F:endonuclease activity  
KEGG abp:AGABI1DRAFT48928  -  
Pfam View protein in Pfam  
PF00961  LAGLIDADG_1  
Amino Acid Sequences SIKLRSNANALRYRLHHKEGLLNLINDVNGQIRNPNRMTQLNKICLKYNLILIWPEKLTKDNGWLSGFFDSDGTITINKTNWQLSISASQKTSELLNPLVELFAGYVYIDNGSSKSFKWYVTKKEDILNLIEYFKKHPSRSAKNNRLHLVPKYYELKNMKAHNAISKTFLAKSWDIFINKWMNYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.48
4 0.42
5 0.48
6 0.45
7 0.49
8 0.45
9 0.39
10 0.35
11 0.32
12 0.3
13 0.22
14 0.2
15 0.13
16 0.1
17 0.1
18 0.15
19 0.17
20 0.24
21 0.25
22 0.28
23 0.31
24 0.37
25 0.42
26 0.45
27 0.51
28 0.53
29 0.57
30 0.55
31 0.53
32 0.48
33 0.47
34 0.38
35 0.33
36 0.26
37 0.22
38 0.23
39 0.2
40 0.21
41 0.18
42 0.18
43 0.15
44 0.16
45 0.17
46 0.16
47 0.21
48 0.2
49 0.23
50 0.23
51 0.23
52 0.22
53 0.2
54 0.19
55 0.13
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.11
67 0.11
68 0.1
69 0.11
70 0.11
71 0.11
72 0.18
73 0.18
74 0.18
75 0.18
76 0.18
77 0.17
78 0.17
79 0.16
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.07
88 0.06
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.06
100 0.07
101 0.07
102 0.11
103 0.12
104 0.14
105 0.22
106 0.27
107 0.35
108 0.42
109 0.46
110 0.43
111 0.46
112 0.47
113 0.41
114 0.37
115 0.32
116 0.25
117 0.22
118 0.22
119 0.19
120 0.19
121 0.25
122 0.28
123 0.26
124 0.33
125 0.42
126 0.5
127 0.6
128 0.69
129 0.72
130 0.74
131 0.81
132 0.77
133 0.72
134 0.67
135 0.61
136 0.57
137 0.49
138 0.47
139 0.44
140 0.42
141 0.45
142 0.44
143 0.45
144 0.45
145 0.47
146 0.47
147 0.45
148 0.47
149 0.46
150 0.47
151 0.42
152 0.39
153 0.37
154 0.35
155 0.31
156 0.31
157 0.29
158 0.26
159 0.27
160 0.28
161 0.31
162 0.31
163 0.3
164 0.34
165 0.37