Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VY50

Protein Details
Accession K5VY50   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRRKKPKKPAKTHSPALSISHydrophilic
30-49MIVAKPKKPNSAKRKVARVKHydrophilic
NLS Segment(s)
PositionSequence
2-12RRKKPKKPAKT
34-47KPKKPNSAKRKVAR
113-117KKSKK
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT85263  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MRRKKPKKPAKTHSPALSISPQKKGVCTQMIVAKPKKPNSAKRKVARVKLSNGNSIMAYIPGEGHNLQEHSVVLVRGGNTKDLPGVAYKVVRGALDFNGVVGRVTARSRYGVKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.7
3 0.63
4 0.61
5 0.58
6 0.52
7 0.48
8 0.47
9 0.43
10 0.43
11 0.42
12 0.41
13 0.36
14 0.34
15 0.32
16 0.33
17 0.37
18 0.42
19 0.42
20 0.42
21 0.44
22 0.48
23 0.54
24 0.55
25 0.6
26 0.64
27 0.71
28 0.75
29 0.75
30 0.81
31 0.79
32 0.8
33 0.78
34 0.73
35 0.68
36 0.67
37 0.63
38 0.56
39 0.49
40 0.42
41 0.32
42 0.27
43 0.21
44 0.12
45 0.1
46 0.06
47 0.06
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.11
64 0.12
65 0.13
66 0.12
67 0.12
68 0.12
69 0.11
70 0.12
71 0.09
72 0.11
73 0.11
74 0.11
75 0.11
76 0.12
77 0.13
78 0.12
79 0.12
80 0.12
81 0.11
82 0.14
83 0.13
84 0.12
85 0.12
86 0.12
87 0.11
88 0.09
89 0.09
90 0.09
91 0.11
92 0.13
93 0.14
94 0.18
95 0.24
96 0.32
97 0.41