Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W0G2

Protein Details
Accession K5W0G2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-123REYYKDKKYKPLDLRPKKTRAIRRRLTKNELSLKTLKQKKKDQNFPRRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
77-122KKYKPLDLRPKKTRAIRRRLTKNELSLKTLKQKKKDQNFPRRKYAV
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT84751  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKTDLLKQLQELKQELLTLRVQKIAGGSAAKLTKIATVRKSIARVLTVINQKARQNLREYYKDKKYKPLDLRPKKTRAIRRRLTKNELSLKTLKQKKKDQNFPRRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.39
4 0.45
5 0.43
6 0.46
7 0.47
8 0.54
9 0.52
10 0.53
11 0.51
12 0.43
13 0.37
14 0.32
15 0.28
16 0.22
17 0.23
18 0.22
19 0.21
20 0.21
21 0.2
22 0.19
23 0.19
24 0.17
25 0.15
26 0.11
27 0.11
28 0.12
29 0.13
30 0.12
31 0.12
32 0.11
33 0.13
34 0.16
35 0.19
36 0.18
37 0.22
38 0.24
39 0.27
40 0.28
41 0.27
42 0.25
43 0.21
44 0.2
45 0.17
46 0.2
47 0.22
48 0.22
49 0.23
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.44
61 0.52
62 0.57
63 0.54
64 0.59
65 0.59
66 0.6
67 0.66
68 0.69
69 0.71
70 0.74
71 0.82
72 0.81
73 0.81
74 0.79
75 0.79
76 0.79
77 0.78
78 0.78
79 0.77
80 0.79
81 0.84
82 0.85
83 0.85
84 0.81
85 0.8
86 0.79
87 0.72
88 0.67
89 0.61
90 0.58
91 0.6
92 0.63
93 0.6
94 0.59
95 0.67
96 0.72
97 0.78
98 0.84
99 0.85
100 0.87
101 0.91
102 0.9
103 0.9
104 0.86