Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XIP1

Protein Details
Accession K5XIP1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
88-111MDMTPRKSKKAKPAQPTPPPPPQPHydrophilic
NLS Segment(s)
PositionSequence
93-100RKSKKAKP
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, cysk 6
Family & Domain DBs
KEGG abp:AGABI1DRAFT133398  -  
Amino Acid Sequences MLDDIEPEHPLYAPFTDCILRAAHVLIKRRDLDGYKTSSVAGIGSFSEQLAKIIGSVDPPPRAFESTPPPPTPSGTATPRPRSPSADMDMTPRKSKKAKPAQPTPPPPPQPPIFWKGPCPPQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.14
5 0.15
6 0.14
7 0.13
8 0.12
9 0.13
10 0.15
11 0.18
12 0.26
13 0.27
14 0.32
15 0.32
16 0.33
17 0.35
18 0.33
19 0.35
20 0.33
21 0.36
22 0.32
23 0.31
24 0.29
25 0.26
26 0.23
27 0.17
28 0.12
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.08
44 0.11
45 0.12
46 0.12
47 0.14
48 0.14
49 0.16
50 0.16
51 0.17
52 0.22
53 0.27
54 0.31
55 0.3
56 0.31
57 0.3
58 0.31
59 0.3
60 0.26
61 0.24
62 0.24
63 0.32
64 0.37
65 0.42
66 0.45
67 0.48
68 0.47
69 0.46
70 0.46
71 0.44
72 0.4
73 0.38
74 0.35
75 0.36
76 0.42
77 0.4
78 0.42
79 0.38
80 0.4
81 0.43
82 0.49
83 0.53
84 0.58
85 0.63
86 0.66
87 0.75
88 0.8
89 0.84
90 0.87
91 0.83
92 0.82
93 0.79
94 0.73
95 0.7
96 0.63
97 0.6
98 0.58
99 0.57
100 0.55
101 0.51
102 0.54
103 0.55