FuNGI

K5Y7E1

Protein Details

Accession

K5Y7E1

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
326-353	LKQGSSTVRSRRKPPKPRPTQKASAAPA	Hydrophilic
379-399	LKESKEVKRRRYQTSTKPAPM	Hydrophilic

NLS Segment(s)

Position	Sequence
334-345	RSRRKPPKPRPT

Subcellular Location(s)

mito 17, nucl 8, cyto_nucl 6

Family & Domain DBs

KEGG	abp:AGABI1DRAFT117580 -

Amino Acid Sequences

MLRTFPKFTTRVRNAKAPEAPPPHTIMPRGRCDLVIGPHRYRDTLFYEVHYMQSSSAIPAVQAPLTSTTSASPPSAPSVSTAATAPSDDQQLAQLKLALGGGTEYTISADLVARIHYEASVNPIFATKFRLAVEPNATQEQIRNFAFALPHLPGVTVSGAPTSLTLSTEQQQQVRLPPVREWDVVMEFNETPNERWLIPRGTLASCSRLVNKGASMLPEASLTLRLPLPDIQATNTSAEESKVSEEKSSDSIPPQAIKFKLPQAPDVIYDLILRWIGGDDKNAANAAALAKIPKRHKIFLPHRIAQGALFTQLQAAQTPNYTLKPLKQGSSTVRSRRKPPKPRPTQKASAAPAPTATLAAGTPDKSATTVSSIKPGKSLKESKEVKRRRYQTSTKPAPMPIRCLVCFKTDVPLMMGGRYCRECVDAGKANIAIPQLPPRTSQSSPNFSPYGPSMNAVSTPVAAVQASQSVSASTTGPVPSPTVATPQLQTPTQNDIPPLTTHAVNTT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.72
3	0.73
4	0.65
5	0.65
6	0.62
7	0.61
8	0.55
9	0.56
10	0.52
11	0.47
12	0.5
13	0.49
14	0.49
15	0.52
16	0.55
17	0.51
18	0.46
19	0.46
20	0.45
21	0.45
22	0.46
23	0.45
24	0.43
25	0.48
26	0.49
27	0.47
28	0.43
29	0.39
30	0.36
31	0.34
32	0.32
33	0.29
34	0.33
35	0.33
36	0.33
37	0.3
38	0.25
39	0.2
40	0.21
41	0.19
42	0.14
43	0.15
44	0.13
45	0.11
46	0.12
47	0.14
48	0.12
49	0.11
50	0.12
51	0.14
52	0.16
53	0.16
54	0.15
55	0.14
56	0.16
57	0.18
58	0.17
59	0.15
60	0.15
61	0.19
62	0.19
63	0.18
64	0.18
65	0.19
66	0.18
67	0.18
68	0.17
69	0.14
70	0.13
71	0.14
72	0.13
73	0.12
74	0.13
75	0.12
76	0.12
77	0.16
78	0.2
79	0.2
80	0.19
81	0.19
82	0.17
83	0.18
84	0.18
85	0.13
86	0.08
87	0.08
88	0.07
89	0.06
90	0.06
91	0.05
92	0.05
93	0.06
94	0.05
95	0.06
96	0.06
97	0.07
98	0.07
99	0.08
100	0.08
101	0.08
102	0.08
103	0.08
104	0.08
105	0.08
106	0.14
107	0.14
108	0.13
109	0.13
110	0.15
111	0.15
112	0.14
113	0.2
114	0.14
115	0.16
116	0.17
117	0.2
118	0.2
119	0.25
120	0.29
121	0.26
122	0.28
123	0.27
124	0.27
125	0.24
126	0.26
127	0.23
128	0.23
129	0.2
130	0.18
131	0.16
132	0.18
133	0.18
134	0.15
135	0.16
136	0.12
137	0.12
138	0.11
139	0.11
140	0.09
141	0.1
142	0.11
143	0.08
144	0.07
145	0.07
146	0.07
147	0.07
148	0.07
149	0.07
150	0.06
151	0.07
152	0.08
153	0.1
154	0.12
155	0.19
156	0.21
157	0.21
158	0.23
159	0.23
160	0.27
161	0.32
162	0.34
163	0.29
164	0.29
165	0.32
166	0.34
167	0.33
168	0.29
169	0.24
170	0.23
171	0.22
172	0.2
173	0.18
174	0.14
175	0.15
176	0.16
177	0.14
178	0.12
179	0.14
180	0.15
181	0.12
182	0.13
183	0.17
184	0.17
185	0.17
186	0.18
187	0.18
188	0.18
189	0.21
190	0.2
191	0.2
192	0.19
193	0.19
194	0.19
195	0.19
196	0.2
197	0.18
198	0.17
199	0.16
200	0.15
201	0.15
202	0.15
203	0.13
204	0.12
205	0.11
206	0.11
207	0.08
208	0.08
209	0.07
210	0.07
211	0.07
212	0.07
213	0.08
214	0.09
215	0.11
216	0.11
217	0.12
218	0.11
219	0.13
220	0.14
221	0.13
222	0.12
223	0.11
224	0.1
225	0.1
226	0.09
227	0.08
228	0.09
229	0.1
230	0.1
231	0.1
232	0.1
233	0.11
234	0.13
235	0.14
236	0.13
237	0.12
238	0.15
239	0.15
240	0.16
241	0.15
242	0.17
243	0.17
244	0.17
245	0.19
246	0.22
247	0.25
248	0.24
249	0.25
250	0.24
251	0.24
252	0.23
253	0.23
254	0.18
255	0.13
256	0.13
257	0.11
258	0.09
259	0.08
260	0.07
261	0.05
262	0.05
263	0.06
264	0.06
265	0.07
266	0.09
267	0.09
268	0.09
269	0.09
270	0.09
271	0.07
272	0.08
273	0.07
274	0.06
275	0.06
276	0.07
277	0.09
278	0.15
279	0.18
280	0.25
281	0.28
282	0.31
283	0.34
284	0.44
285	0.52
286	0.56
287	0.62
288	0.58
289	0.56
290	0.53
291	0.49
292	0.38
293	0.31
294	0.21
295	0.14
296	0.1
297	0.08
298	0.08
299	0.09
300	0.09
301	0.08
302	0.08
303	0.07
304	0.08
305	0.1
306	0.11
307	0.11
308	0.13
309	0.14
310	0.16
311	0.24
312	0.25
313	0.26
314	0.25
315	0.3
316	0.33
317	0.4
318	0.45
319	0.46
320	0.53
321	0.55
322	0.63
323	0.69
324	0.74
325	0.77
326	0.81
327	0.83
328	0.85
329	0.92
330	0.91
331	0.89
332	0.87
333	0.83
334	0.81
335	0.73
336	0.68
337	0.59
338	0.5
339	0.42
340	0.34
341	0.27
342	0.18
343	0.14
344	0.08
345	0.06
346	0.08
347	0.09
348	0.08
349	0.09
350	0.09
351	0.09
352	0.09
353	0.1
354	0.09
355	0.12
356	0.16
357	0.16
358	0.24
359	0.26
360	0.26
361	0.31
362	0.33
363	0.32
364	0.37
365	0.44
366	0.4
367	0.48
368	0.55
369	0.59
370	0.68
371	0.73
372	0.73
373	0.75
374	0.78
375	0.77
376	0.8
377	0.8
378	0.8
379	0.82
380	0.83
381	0.79
382	0.75
383	0.72
384	0.71
385	0.64
386	0.59
387	0.54
388	0.5
389	0.45
390	0.46
391	0.42
392	0.36
393	0.36
394	0.31
395	0.31
396	0.27
397	0.26
398	0.23
399	0.26
400	0.23
401	0.22
402	0.24
403	0.19
404	0.22
405	0.23
406	0.22
407	0.18
408	0.19
409	0.18
410	0.19
411	0.26
412	0.29
413	0.29
414	0.31
415	0.31
416	0.29
417	0.3
418	0.28
419	0.21
420	0.15
421	0.23
422	0.23
423	0.24
424	0.26
425	0.3
426	0.35
427	0.36
428	0.44
429	0.44
430	0.49
431	0.5
432	0.54
433	0.5
434	0.43
435	0.45
436	0.37
437	0.35
438	0.28
439	0.26
440	0.22
441	0.22
442	0.23
443	0.2
444	0.19
445	0.13
446	0.12
447	0.11
448	0.1
449	0.09
450	0.09
451	0.08
452	0.11
453	0.11
454	0.11
455	0.11
456	0.1
457	0.11
458	0.12
459	0.12
460	0.1
461	0.12
462	0.13
463	0.13
464	0.14
465	0.15
466	0.15
467	0.17
468	0.17
469	0.2
470	0.22
471	0.23
472	0.23
473	0.26
474	0.3
475	0.29
476	0.31
477	0.29
478	0.35
479	0.36
480	0.37
481	0.34
482	0.33
483	0.33
484	0.32
485	0.34
486	0.28
487	0.25

K5Y7E1

3D AlphaFold-predicted Structure Viewer