Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WHF1

Protein Details
Accession K5WHF1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-79TPKGRYTQERKDKMDKQHEGBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 7
Family & Domain DBs
KEGG abp:AGABI1DRAFT16943  -  
Amino Acid Sequences EEMTEQSEPLLSLAKKYKPVALKVRPVLGELPEKFRIIRNITGDPLADLPKLPSNPPEFTPKGRYTQERKDKMDKQHEGGFLLPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.34
4 0.39
5 0.38
6 0.46
7 0.52
8 0.53
9 0.58
10 0.55
11 0.58
12 0.52
13 0.48
14 0.42
15 0.34
16 0.34
17 0.26
18 0.29
19 0.26
20 0.26
21 0.25
22 0.26
23 0.29
24 0.25
25 0.28
26 0.26
27 0.26
28 0.26
29 0.26
30 0.24
31 0.19
32 0.17
33 0.13
34 0.09
35 0.08
36 0.08
37 0.12
38 0.13
39 0.13
40 0.16
41 0.2
42 0.22
43 0.24
44 0.3
45 0.29
46 0.32
47 0.39
48 0.37
49 0.39
50 0.43
51 0.49
52 0.49
53 0.57
54 0.64
55 0.65
56 0.69
57 0.73
58 0.75
59 0.77
60 0.8
61 0.76
62 0.7
63 0.69
64 0.64
65 0.56
66 0.5