Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VMQ1

Protein Details
Accession K5VMQ1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
273-312EKDAKRVPKRALLKQERREKEEERRNKKKEWEASRFEIPKBasic
NLS Segment(s)
PositionSequence
63-79KETEKERKAKEAKAREI
276-302AKRVPKRALLKQERREKEEERRNKKKE
Subcellular Location(s) mito 17, mito_nucl 12.999, cyto_mito 10.499, nucl 7.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
Gene Ontology GO:0006413  P:translational initiation  
KEGG abp:AGABI1DRAFT109226  -  
Amino Acid Sequences MSTFSAFRSIAIRRFLHSKTPPFLSSTSRYGVIKPTSRETHRAFHFTVIRRAYDRNDQPPVRKETEKERKAKEAKAREIGLRGRNIPYDIVRVRHQGALSNSRRLSDVLEEVDSLNLAAANEAQHTEDFPLSSSKIKKKYVAELVVNKPSPIVAIIDTKAAFEKQKRRHEQVKNSSVHNVRKEIQLTWATSPADVETKLERMKDDLQKGYRIDLAVSPKQGTPVPQLAKMQERVEEIVSQVAELAREWQEREYTKNTAVVYLQGIPVPSSSTEKDAKRVPKRALLKQERREKEEERRNKKKEWEASRFEIPKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.46
4 0.49
5 0.52
6 0.5
7 0.54
8 0.52
9 0.5
10 0.5
11 0.46
12 0.43
13 0.4
14 0.37
15 0.35
16 0.34
17 0.32
18 0.37
19 0.38
20 0.39
21 0.39
22 0.44
23 0.49
24 0.53
25 0.59
26 0.56
27 0.57
28 0.56
29 0.58
30 0.51
31 0.5
32 0.53
33 0.51
34 0.54
35 0.48
36 0.45
37 0.42
38 0.44
39 0.42
40 0.44
41 0.46
42 0.46
43 0.52
44 0.54
45 0.58
46 0.63
47 0.66
48 0.61
49 0.58
50 0.53
51 0.55
52 0.62
53 0.64
54 0.64
55 0.62
56 0.66
57 0.69
58 0.73
59 0.72
60 0.71
61 0.7
62 0.69
63 0.66
64 0.58
65 0.58
66 0.57
67 0.53
68 0.46
69 0.41
70 0.36
71 0.35
72 0.33
73 0.3
74 0.25
75 0.26
76 0.25
77 0.25
78 0.26
79 0.28
80 0.29
81 0.29
82 0.28
83 0.26
84 0.28
85 0.35
86 0.36
87 0.4
88 0.38
89 0.36
90 0.36
91 0.32
92 0.29
93 0.21
94 0.2
95 0.15
96 0.15
97 0.15
98 0.14
99 0.13
100 0.11
101 0.08
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.09
119 0.13
120 0.19
121 0.24
122 0.3
123 0.33
124 0.38
125 0.39
126 0.45
127 0.48
128 0.48
129 0.46
130 0.46
131 0.48
132 0.48
133 0.45
134 0.38
135 0.3
136 0.25
137 0.2
138 0.14
139 0.1
140 0.06
141 0.07
142 0.08
143 0.09
144 0.1
145 0.1
146 0.1
147 0.1
148 0.11
149 0.15
150 0.24
151 0.32
152 0.42
153 0.49
154 0.55
155 0.64
156 0.71
157 0.76
158 0.77
159 0.77
160 0.69
161 0.64
162 0.64
163 0.6
164 0.56
165 0.49
166 0.42
167 0.34
168 0.35
169 0.35
170 0.29
171 0.29
172 0.26
173 0.25
174 0.23
175 0.25
176 0.21
177 0.19
178 0.19
179 0.15
180 0.13
181 0.11
182 0.12
183 0.1
184 0.13
185 0.14
186 0.15
187 0.14
188 0.16
189 0.23
190 0.28
191 0.32
192 0.35
193 0.36
194 0.4
195 0.4
196 0.38
197 0.33
198 0.27
199 0.22
200 0.2
201 0.24
202 0.22
203 0.23
204 0.23
205 0.22
206 0.23
207 0.23
208 0.22
209 0.21
210 0.26
211 0.27
212 0.28
213 0.3
214 0.31
215 0.36
216 0.37
217 0.33
218 0.28
219 0.28
220 0.26
221 0.25
222 0.23
223 0.18
224 0.17
225 0.15
226 0.12
227 0.11
228 0.1
229 0.09
230 0.08
231 0.11
232 0.12
233 0.13
234 0.15
235 0.16
236 0.21
237 0.22
238 0.27
239 0.29
240 0.29
241 0.3
242 0.33
243 0.31
244 0.28
245 0.27
246 0.23
247 0.21
248 0.19
249 0.17
250 0.14
251 0.15
252 0.13
253 0.13
254 0.13
255 0.12
256 0.15
257 0.15
258 0.19
259 0.26
260 0.27
261 0.33
262 0.39
263 0.48
264 0.53
265 0.6
266 0.61
267 0.63
268 0.7
269 0.74
270 0.78
271 0.79
272 0.8
273 0.81
274 0.86
275 0.84
276 0.82
277 0.8
278 0.76
279 0.76
280 0.76
281 0.77
282 0.77
283 0.81
284 0.8
285 0.82
286 0.84
287 0.83
288 0.82
289 0.82
290 0.81
291 0.78
292 0.79
293 0.81