Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WBL4

Protein Details
Accession K5WBL4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
117-142MATQKEPKASPPRKTRGKKSKAAESSHydrophilic
NLS Segment(s)
PositionSequence
122-138EPKASPPRKTRGKKSKA
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT81985  -  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLQWLLLRKNNSHIVKRGPIFSKEPGNLRNIHSFKYSGFANAKTIDVSDSNGAIRITTRKVNASPHAVAAAATVAPIRARSGGRRALGVGASVAKRGYRPDLRAAVLARISALMATQKEPKASPPRKTRGKKSKAAESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.51
4 0.53
5 0.57
6 0.58
7 0.58
8 0.53
9 0.51
10 0.49
11 0.48
12 0.49
13 0.44
14 0.46
15 0.42
16 0.41
17 0.4
18 0.39
19 0.45
20 0.38
21 0.37
22 0.34
23 0.32
24 0.28
25 0.28
26 0.25
27 0.2
28 0.21
29 0.2
30 0.2
31 0.2
32 0.2
33 0.17
34 0.17
35 0.13
36 0.11
37 0.12
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.08
44 0.09
45 0.1
46 0.11
47 0.14
48 0.15
49 0.16
50 0.18
51 0.22
52 0.24
53 0.27
54 0.25
55 0.22
56 0.21
57 0.19
58 0.17
59 0.13
60 0.1
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.06
69 0.07
70 0.1
71 0.16
72 0.21
73 0.21
74 0.22
75 0.22
76 0.21
77 0.2
78 0.18
79 0.13
80 0.1
81 0.1
82 0.1
83 0.1
84 0.09
85 0.1
86 0.12
87 0.19
88 0.22
89 0.24
90 0.31
91 0.34
92 0.35
93 0.38
94 0.37
95 0.33
96 0.28
97 0.24
98 0.18
99 0.14
100 0.12
101 0.09
102 0.08
103 0.08
104 0.09
105 0.12
106 0.18
107 0.19
108 0.22
109 0.22
110 0.3
111 0.38
112 0.45
113 0.53
114 0.57
115 0.66
116 0.75
117 0.84
118 0.87
119 0.87
120 0.88
121 0.87
122 0.85