Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X4R4

Protein Details
Accession K5X4R4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-84VKKEAFKRVRPELRTRLKKLBasic
NLS Segment(s)
PositionSequence
66-88KKEAFKRVRPELRTRLKKLLKER
Subcellular Location(s) mito 16.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 5.833
Family & Domain DBs
KEGG abp:AGABI1DRAFT111417  -  
Amino Acid Sequences MKASAIRLIRIIPRKALDPSSAKILDAPPSQIQELHQPTVLDLLKQQREEAGPEWPANIRLEPVVKKEAFKRVRPELRTRLKKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.4
4 0.38
5 0.34
6 0.33
7 0.36
8 0.34
9 0.3
10 0.28
11 0.27
12 0.27
13 0.23
14 0.25
15 0.19
16 0.2
17 0.21
18 0.2
19 0.19
20 0.22
21 0.24
22 0.22
23 0.22
24 0.2
25 0.19
26 0.24
27 0.23
28 0.14
29 0.13
30 0.18
31 0.2
32 0.2
33 0.2
34 0.16
35 0.17
36 0.19
37 0.18
38 0.16
39 0.15
40 0.15
41 0.16
42 0.15
43 0.16
44 0.15
45 0.14
46 0.11
47 0.11
48 0.15
49 0.16
50 0.19
51 0.24
52 0.24
53 0.26
54 0.3
55 0.39
56 0.42
57 0.46
58 0.51
59 0.55
60 0.63
61 0.67
62 0.72
63 0.72
64 0.77
65 0.81
66 0.79
67 0.79
68 0.78