Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WSG3

Protein Details
Accession K5WSG3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) nucl 12, cyto 11, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT49828  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.4
5 0.45
6 0.5
7 0.54
8 0.6
9 0.61
10 0.66
11 0.75
12 0.82
13 0.85
14 0.84
15 0.82
16 0.82
17 0.79
18 0.7
19 0.61
20 0.52
21 0.44
22 0.38
23 0.32
24 0.25
25 0.22
26 0.2
27 0.2
28 0.19
29 0.17
30 0.18
31 0.24
32 0.22
33 0.21
34 0.21
35 0.23
36 0.26
37 0.26
38 0.27
39 0.24
40 0.26
41 0.24
42 0.26
43 0.24
44 0.2
45 0.19
46 0.16
47 0.12
48 0.09
49 0.08
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.12
64 0.11
65 0.14
66 0.14
67 0.18
68 0.21