Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X8N8

Protein Details
Accession K5X8N8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
138-159VDPPPKRRRVELRRSTRQQEKABasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
KEGG abp:AGABI1DRAFT113942  -  
Amino Acid Sequences MSKLAPRVSSSVIRSIDSKKLWDSLQRNTKDDLVDVDDSSISIASPGEANHRKDEETRDPNTKPADPSSKVEALNRLRYAPYHSTLPKRIEPQAGVSILNKGNHEESIEGSLSAKPFARVNIQKAEGNDEESIEVSLVDPPPKRRRVELRRSTRQQEKAQNIDPDELILVFPYGVPGAVNVTRSDLARLDPEALLNDTLIEFGLKFWLKKLEFENPALASQVYLFNSFFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.4
4 0.36
5 0.37
6 0.31
7 0.33
8 0.34
9 0.4
10 0.41
11 0.43
12 0.51
13 0.52
14 0.53
15 0.52
16 0.53
17 0.44
18 0.4
19 0.33
20 0.28
21 0.25
22 0.22
23 0.21
24 0.17
25 0.16
26 0.15
27 0.12
28 0.07
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.15
35 0.21
36 0.24
37 0.29
38 0.3
39 0.31
40 0.34
41 0.41
42 0.42
43 0.43
44 0.45
45 0.47
46 0.47
47 0.5
48 0.51
49 0.46
50 0.39
51 0.38
52 0.41
53 0.37
54 0.4
55 0.41
56 0.41
57 0.39
58 0.38
59 0.4
60 0.37
61 0.41
62 0.38
63 0.33
64 0.3
65 0.29
66 0.34
67 0.29
68 0.27
69 0.26
70 0.29
71 0.33
72 0.39
73 0.43
74 0.4
75 0.4
76 0.41
77 0.38
78 0.35
79 0.33
80 0.31
81 0.27
82 0.24
83 0.2
84 0.21
85 0.2
86 0.2
87 0.17
88 0.14
89 0.14
90 0.14
91 0.14
92 0.11
93 0.09
94 0.1
95 0.1
96 0.09
97 0.09
98 0.1
99 0.09
100 0.1
101 0.09
102 0.07
103 0.08
104 0.09
105 0.15
106 0.17
107 0.21
108 0.25
109 0.27
110 0.27
111 0.27
112 0.31
113 0.24
114 0.24
115 0.2
116 0.16
117 0.14
118 0.13
119 0.12
120 0.07
121 0.07
122 0.05
123 0.06
124 0.07
125 0.1
126 0.12
127 0.19
128 0.27
129 0.33
130 0.35
131 0.39
132 0.49
133 0.57
134 0.66
135 0.7
136 0.72
137 0.77
138 0.82
139 0.83
140 0.81
141 0.78
142 0.75
143 0.74
144 0.71
145 0.67
146 0.66
147 0.63
148 0.56
149 0.49
150 0.41
151 0.32
152 0.25
153 0.18
154 0.12
155 0.08
156 0.06
157 0.05
158 0.04
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.07
165 0.09
166 0.1
167 0.1
168 0.13
169 0.14
170 0.15
171 0.16
172 0.14
173 0.14
174 0.15
175 0.16
176 0.16
177 0.15
178 0.15
179 0.15
180 0.16
181 0.15
182 0.12
183 0.12
184 0.09
185 0.09
186 0.08
187 0.07
188 0.05
189 0.05
190 0.12
191 0.13
192 0.13
193 0.16
194 0.25
195 0.25
196 0.3
197 0.35
198 0.38
199 0.41
200 0.43
201 0.47
202 0.39
203 0.39
204 0.36
205 0.31
206 0.21
207 0.18
208 0.2
209 0.16
210 0.16