Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WT73

Protein Details
Accession K5WT73    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTRYQEKKKTYPARRGNWRLSQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
KEGG abp:AGABI1DRAFT134133  -  
Amino Acid Sequences MTRYQEKKKTYPARRGNWRLSQSLSNRFCQNGHEVSVAEWLRLVLPAALQLTQDLVSGSRLEWVQVMTPPHAPSAQSGAGPGSRASDLTVATADDDRLVDEGAGRSARDGIMNVDPRDTSVTMGRCPHEADGVLEDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.86
4 0.85
5 0.79
6 0.72
7 0.66
8 0.64
9 0.59
10 0.6
11 0.55
12 0.49
13 0.47
14 0.45
15 0.41
16 0.36
17 0.35
18 0.27
19 0.27
20 0.24
21 0.22
22 0.21
23 0.27
24 0.24
25 0.18
26 0.16
27 0.13
28 0.12
29 0.12
30 0.12
31 0.05
32 0.05
33 0.06
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.09
53 0.11
54 0.1
55 0.12
56 0.12
57 0.12
58 0.12
59 0.12
60 0.1
61 0.13
62 0.13
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.1
69 0.08
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.07
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.1
95 0.09
96 0.1
97 0.11
98 0.18
99 0.24
100 0.23
101 0.24
102 0.24
103 0.24
104 0.27
105 0.24
106 0.19
107 0.19
108 0.22
109 0.24
110 0.29
111 0.29
112 0.27
113 0.29
114 0.28
115 0.25
116 0.24
117 0.22
118 0.21