Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XSU6

Protein Details
Accession K5XSU6   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-233KDAGKNKDKVKGKAKKPKKESKKLLSFGDDBasic
NLS Segment(s)
PositionSequence
61-71PIPKRPPIPKR
195-226KKLGPNAKSKDAGKNKDKVKGKAKKPKKESKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG abp:AGABI1DRAFT114881  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPPRELSRQQLSSKLSYQHQVPAFLQKFQNRLAGKPEVASDEDEPQYDNEEFEYVGGGRPPIPKRPPIPKRPASQPGSADERDDDERDEEGDEKPQIVVLREGKHLSARDVENVKRKAKGLPPLPEVNYSSEAKEDGSEVATKKSKDDTKPSSSKSKGLSFSSGKPITKISIKRKAITQPDSDSEDDLASQMGIKKLGPNAKSKDAGKNKDKVKGKAKKPKKESKKLLSFGDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.43
4 0.43
5 0.43
6 0.41
7 0.41
8 0.37
9 0.42
10 0.4
11 0.41
12 0.44
13 0.41
14 0.41
15 0.4
16 0.46
17 0.37
18 0.38
19 0.39
20 0.38
21 0.34
22 0.32
23 0.31
24 0.26
25 0.26
26 0.27
27 0.22
28 0.22
29 0.22
30 0.21
31 0.2
32 0.18
33 0.2
34 0.17
35 0.16
36 0.12
37 0.11
38 0.11
39 0.1
40 0.11
41 0.07
42 0.08
43 0.08
44 0.08
45 0.1
46 0.17
47 0.2
48 0.27
49 0.31
50 0.36
51 0.42
52 0.53
53 0.6
54 0.64
55 0.72
56 0.71
57 0.73
58 0.75
59 0.78
60 0.71
61 0.67
62 0.59
63 0.53
64 0.52
65 0.46
66 0.38
67 0.29
68 0.28
69 0.24
70 0.23
71 0.19
72 0.14
73 0.14
74 0.14
75 0.14
76 0.12
77 0.1
78 0.13
79 0.12
80 0.11
81 0.1
82 0.11
83 0.11
84 0.11
85 0.14
86 0.15
87 0.17
88 0.19
89 0.2
90 0.19
91 0.21
92 0.21
93 0.18
94 0.18
95 0.16
96 0.19
97 0.22
98 0.25
99 0.3
100 0.34
101 0.35
102 0.33
103 0.33
104 0.33
105 0.34
106 0.39
107 0.37
108 0.38
109 0.41
110 0.43
111 0.43
112 0.41
113 0.37
114 0.32
115 0.28
116 0.23
117 0.19
118 0.16
119 0.15
120 0.13
121 0.12
122 0.1
123 0.07
124 0.07
125 0.09
126 0.09
127 0.13
128 0.16
129 0.16
130 0.17
131 0.23
132 0.28
133 0.31
134 0.39
135 0.42
136 0.48
137 0.55
138 0.57
139 0.6
140 0.56
141 0.56
142 0.52
143 0.51
144 0.46
145 0.42
146 0.44
147 0.38
148 0.39
149 0.44
150 0.43
151 0.37
152 0.34
153 0.33
154 0.3
155 0.34
156 0.39
157 0.4
158 0.46
159 0.5
160 0.51
161 0.55
162 0.6
163 0.62
164 0.59
165 0.55
166 0.49
167 0.49
168 0.51
169 0.47
170 0.39
171 0.31
172 0.26
173 0.2
174 0.15
175 0.12
176 0.07
177 0.08
178 0.09
179 0.1
180 0.1
181 0.11
182 0.14
183 0.2
184 0.26
185 0.28
186 0.33
187 0.38
188 0.44
189 0.5
190 0.5
191 0.55
192 0.58
193 0.65
194 0.64
195 0.67
196 0.65
197 0.69
198 0.74
199 0.72
200 0.73
201 0.74
202 0.77
203 0.8
204 0.85
205 0.87
206 0.89
207 0.91
208 0.92
209 0.93
210 0.93
211 0.93
212 0.93
213 0.88
214 0.84