Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WV52

Protein Details
Accession K5WV52    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-32IDKGLVKKKKIPTKKLEQPITCHydrophilic
NLS Segment(s)
PositionSequence
18-20KKK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT25202  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MIDSGCTHTCIDKGLVKKKKIPTKKLEQPITCRNSDGTIAGKKDITKFVKMDLNIKGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.48
4 0.55
5 0.62
6 0.69
7 0.74
8 0.76
9 0.74
10 0.77
11 0.82
12 0.84
13 0.84
14 0.79
15 0.76
16 0.76
17 0.72
18 0.61
19 0.52
20 0.43
21 0.35
22 0.31
23 0.24
24 0.19
25 0.18
26 0.18
27 0.18
28 0.18
29 0.18
30 0.19
31 0.24
32 0.23
33 0.22
34 0.21
35 0.23
36 0.26
37 0.26
38 0.28
39 0.26
40 0.27
41 0.25
42 0.27
43 0.25
44 0.23
45 0.23
46 0.19
47 0.15
48 0.12
49 0.12
50 0.1
51 0.09
52 0.09
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.07
59 0.08
60 0.07
61 0.08
62 0.09
63 0.11
64 0.1
65 0.13
66 0.13
67 0.17
68 0.2
69 0.21
70 0.22
71 0.23
72 0.23
73 0.28