Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XG27

Protein Details
Accession K5XG27    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RRRKIPTKKLERPITCRNSDBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT50093  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
Amino Acid Sequences RRRKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.66
4 0.58
5 0.5
6 0.43
7 0.37
8 0.31
9 0.27
10 0.25
11 0.25
12 0.23
13 0.21
14 0.23
15 0.29
16 0.27
17 0.25
18 0.24
19 0.26
20 0.29
21 0.28
22 0.29
23 0.25
24 0.25
25 0.23
26 0.25
27 0.22
28 0.18
29 0.17
30 0.15
31 0.11
32 0.08
33 0.07
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.07
43 0.08
44 0.07
45 0.09
46 0.09
47 0.12
48 0.11
49 0.14
50 0.14
51 0.18
52 0.24