Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WY28

Protein Details
Accession K5WY28   
Localization Confidence High
Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHKKAKRLLREEQRKQKGTNBasic
44-66ASQIRDTYKKKRKLEEEGRDAKRBasic
NLS Segment(s)
PositionSequence
6-8AKR
52-71KKKRKLEEEGRDAKREKRRK
112-116RKAHK
121-125AKAKE
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
KEGG abp:AGABI1DRAFT79835  -  
Amino Acid Sequences MPHKKAKRLLREEQRKQKGTNLAPSKESLDNEGIPKSASRVLNASQIRDTYKKKRKLEEEGRDAKREKRRKMDDMQLKIKPGEPIHHFYKRVEDDMRPMVRSAVRSSKAVERKAHKDALEAKAKERRGVGSEGQESREQTPPLHVEPQRKDTKKDNSLERHKDFEKYSTSAPRRLNDVAQAPPEIKKAPRGASHSGLGGKREGVLSMAQKSMMEQEREKVINRYRMLKASRLKTSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.86
3 0.79
4 0.76
5 0.75
6 0.7
7 0.7
8 0.67
9 0.6
10 0.57
11 0.57
12 0.53
13 0.47
14 0.41
15 0.35
16 0.3
17 0.29
18 0.29
19 0.28
20 0.24
21 0.2
22 0.2
23 0.18
24 0.21
25 0.19
26 0.19
27 0.21
28 0.23
29 0.31
30 0.32
31 0.32
32 0.28
33 0.29
34 0.31
35 0.34
36 0.39
37 0.42
38 0.5
39 0.57
40 0.62
41 0.7
42 0.73
43 0.78
44 0.82
45 0.81
46 0.82
47 0.82
48 0.79
49 0.75
50 0.7
51 0.67
52 0.66
53 0.65
54 0.63
55 0.63
56 0.67
57 0.69
58 0.74
59 0.76
60 0.76
61 0.75
62 0.74
63 0.66
64 0.6
65 0.53
66 0.48
67 0.42
68 0.33
69 0.31
70 0.28
71 0.31
72 0.35
73 0.4
74 0.39
75 0.36
76 0.43
77 0.39
78 0.38
79 0.35
80 0.29
81 0.28
82 0.34
83 0.35
84 0.27
85 0.25
86 0.24
87 0.23
88 0.23
89 0.22
90 0.22
91 0.22
92 0.23
93 0.25
94 0.3
95 0.35
96 0.38
97 0.4
98 0.39
99 0.42
100 0.46
101 0.47
102 0.4
103 0.38
104 0.39
105 0.39
106 0.42
107 0.37
108 0.35
109 0.37
110 0.38
111 0.35
112 0.3
113 0.26
114 0.21
115 0.23
116 0.23
117 0.22
118 0.26
119 0.25
120 0.26
121 0.26
122 0.25
123 0.24
124 0.26
125 0.21
126 0.17
127 0.2
128 0.2
129 0.21
130 0.27
131 0.28
132 0.33
133 0.36
134 0.44
135 0.5
136 0.5
137 0.52
138 0.53
139 0.6
140 0.6
141 0.62
142 0.62
143 0.63
144 0.71
145 0.76
146 0.7
147 0.66
148 0.59
149 0.58
150 0.5
151 0.45
152 0.39
153 0.33
154 0.34
155 0.38
156 0.4
157 0.43
158 0.46
159 0.43
160 0.44
161 0.43
162 0.41
163 0.36
164 0.36
165 0.33
166 0.3
167 0.3
168 0.25
169 0.25
170 0.26
171 0.23
172 0.2
173 0.24
174 0.27
175 0.31
176 0.36
177 0.41
178 0.44
179 0.45
180 0.45
181 0.42
182 0.42
183 0.38
184 0.33
185 0.28
186 0.23
187 0.2
188 0.19
189 0.16
190 0.12
191 0.14
192 0.16
193 0.18
194 0.18
195 0.17
196 0.17
197 0.17
198 0.24
199 0.26
200 0.27
201 0.26
202 0.29
203 0.35
204 0.37
205 0.39
206 0.4
207 0.42
208 0.47
209 0.49
210 0.52
211 0.5
212 0.56
213 0.58
214 0.58
215 0.59
216 0.59
217 0.63