Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5Y7C9

Protein Details
Accession K5Y7C9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VVEGGIVKKKKKKSKRKAERDELVMEBasic
NLS Segment(s)
PositionSequence
23-35IVKKKKKKSKRKA
Subcellular Location(s) nucl 16, cyto_nucl 14.333, cyto 9.5, mito_nucl 9.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG abp:AGABI1DRAFT81835  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYDLRPGGSLKLKGAVVEGGIVKKKKKKSKRKAERDELVMENVVKQVIQEDKPGSASGSGRNTPTVVGSSDSGPRKTDAERRFEETQKKRLAERVAKLAGKTHKDRVNDFNAKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.21
5 0.14
6 0.15
7 0.15
8 0.14
9 0.19
10 0.22
11 0.27
12 0.33
13 0.43
14 0.51
15 0.6
16 0.69
17 0.75
18 0.83
19 0.89
20 0.93
21 0.95
22 0.94
23 0.9
24 0.84
25 0.78
26 0.68
27 0.58
28 0.48
29 0.37
30 0.27
31 0.2
32 0.15
33 0.09
34 0.07
35 0.08
36 0.1
37 0.11
38 0.14
39 0.14
40 0.15
41 0.16
42 0.16
43 0.14
44 0.12
45 0.11
46 0.12
47 0.15
48 0.16
49 0.16
50 0.16
51 0.16
52 0.14
53 0.14
54 0.11
55 0.08
56 0.08
57 0.08
58 0.09
59 0.15
60 0.16
61 0.17
62 0.17
63 0.17
64 0.18
65 0.2
66 0.28
67 0.27
68 0.33
69 0.35
70 0.4
71 0.44
72 0.48
73 0.55
74 0.53
75 0.56
76 0.55
77 0.55
78 0.5
79 0.52
80 0.55
81 0.53
82 0.5
83 0.5
84 0.49
85 0.49
86 0.47
87 0.48
88 0.46
89 0.45
90 0.45
91 0.45
92 0.45
93 0.47
94 0.51
95 0.52
96 0.55
97 0.56
98 0.52
99 0.5
100 0.46
101 0.42
102 0.37
103 0.31
104 0.23
105 0.17
106 0.21
107 0.18
108 0.19
109 0.21
110 0.23
111 0.22