Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X3H7

Protein Details
Accession K5X3H7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28MEPLPLPPAKKRKGKKEKAVDVPTDHydrophilic
NLS Segment(s)
PositionSequence
11-21PAKKRKGKKEK
Subcellular Location(s) cyto_nucl 13, nucl 12, cyto 12
Family & Domain DBs
KEGG abp:AGABI1DRAFT130001  -  
Amino Acid Sequences MAFMEPLPLPPAKKRKGKKEKAVDVPTDHGLVNEFILDDRLCVLPRDLRLMGPYVTQIAFNPIAQYSPDSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.76
4 0.84
5 0.86
6 0.87
7 0.88
8 0.89
9 0.86
10 0.78
11 0.7
12 0.62
13 0.53
14 0.43
15 0.33
16 0.22
17 0.17
18 0.14
19 0.1
20 0.07
21 0.06
22 0.05
23 0.06
24 0.06
25 0.04
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.11
32 0.12
33 0.17
34 0.16
35 0.16
36 0.17
37 0.19
38 0.18
39 0.16
40 0.16
41 0.13
42 0.12
43 0.12
44 0.11
45 0.14
46 0.15
47 0.15
48 0.15
49 0.14
50 0.14
51 0.15