Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WDS3

Protein Details
Accession K5WDS3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-81ELARDEENKRRKKKRLPPLTGPIFBasic
NLS Segment(s)
PositionSequence
66-73KRRKKKRL
Subcellular Location(s) nucl 13, cyto 4, mito 3, golg 2, vacu 2, plas 1, pero 1, E.R. 1
Family & Domain DBs
KEGG abp:AGABI1DRAFT134832  -  
Amino Acid Sequences MVCSLFVRGINHYDLDGITTIRGLILFLQDNPQAFSFEPPELPRHADESWLAYRKELELARDEENKRRKKKRLPPLTGPIFLHESIEFTRHWNVWEIDDGWGDIFRAIERGTKPVSQAVLKRGRRGLFFFYLVYERFCFFAYLSLQPRRLDTDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.11
5 0.09
6 0.08
7 0.08
8 0.07
9 0.07
10 0.06
11 0.05
12 0.08
13 0.09
14 0.1
15 0.14
16 0.15
17 0.16
18 0.17
19 0.17
20 0.16
21 0.15
22 0.17
23 0.16
24 0.16
25 0.17
26 0.17
27 0.19
28 0.2
29 0.22
30 0.2
31 0.21
32 0.2
33 0.2
34 0.19
35 0.21
36 0.25
37 0.26
38 0.25
39 0.21
40 0.22
41 0.21
42 0.25
43 0.21
44 0.17
45 0.17
46 0.2
47 0.23
48 0.3
49 0.31
50 0.34
51 0.42
52 0.49
53 0.55
54 0.61
55 0.66
56 0.7
57 0.78
58 0.81
59 0.83
60 0.83
61 0.81
62 0.82
63 0.78
64 0.7
65 0.6
66 0.51
67 0.42
68 0.34
69 0.27
70 0.17
71 0.14
72 0.11
73 0.12
74 0.11
75 0.1
76 0.12
77 0.12
78 0.13
79 0.15
80 0.15
81 0.15
82 0.17
83 0.16
84 0.15
85 0.15
86 0.14
87 0.1
88 0.1
89 0.09
90 0.07
91 0.06
92 0.05
93 0.06
94 0.06
95 0.11
96 0.11
97 0.15
98 0.17
99 0.18
100 0.2
101 0.21
102 0.24
103 0.23
104 0.26
105 0.32
106 0.39
107 0.41
108 0.45
109 0.48
110 0.48
111 0.47
112 0.48
113 0.45
114 0.39
115 0.39
116 0.34
117 0.3
118 0.31
119 0.28
120 0.27
121 0.22
122 0.19
123 0.18
124 0.18
125 0.17
126 0.14
127 0.18
128 0.18
129 0.24
130 0.31
131 0.36
132 0.4
133 0.4
134 0.42