Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WGT0

Protein Details
Accession K5WGT0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-62ELARDEENKRRKKKRLPPLVGPIFBasic
NLS Segment(s)
PositionSequence
47-54KRRKKKRL
Subcellular Location(s) nucl 11, cyto 9, mito 3, pero 3
Family & Domain DBs
KEGG abp:AGABI1DRAFT95606  -  
Amino Acid Sequences MIRGLILFLQDNPQAFSFEPPELPRQADESWPAYRRELELARDEENKRRKKKRLPPLVGPIFLHESIEFTRHWNVWEMDDGWGDIFRAIERGNKPVSQAVLKRASTSSAGYGLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.2
4 0.19
5 0.18
6 0.2
7 0.2
8 0.24
9 0.24
10 0.25
11 0.22
12 0.23
13 0.23
14 0.23
15 0.24
16 0.24
17 0.27
18 0.28
19 0.29
20 0.26
21 0.26
22 0.25
23 0.27
24 0.25
25 0.24
26 0.26
27 0.27
28 0.29
29 0.33
30 0.34
31 0.37
32 0.43
33 0.49
34 0.53
35 0.6
36 0.66
37 0.71
38 0.79
39 0.82
40 0.84
41 0.82
42 0.8
43 0.81
44 0.76
45 0.67
46 0.57
47 0.48
48 0.39
49 0.32
50 0.25
51 0.14
52 0.12
53 0.11
54 0.12
55 0.11
56 0.1
57 0.12
58 0.12
59 0.13
60 0.16
61 0.16
62 0.16
63 0.18
64 0.17
65 0.16
66 0.16
67 0.15
68 0.11
69 0.11
70 0.1
71 0.07
72 0.06
73 0.05
74 0.07
75 0.07
76 0.14
77 0.15
78 0.2
79 0.23
80 0.23
81 0.25
82 0.27
83 0.3
84 0.3
85 0.32
86 0.35
87 0.4
88 0.39
89 0.4
90 0.37
91 0.36
92 0.32
93 0.31
94 0.25
95 0.19