Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XFQ9

Protein Details
Accession K5XFQ9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-92GQNPGRPQRKRKGPRPLPQLPNIRPPPRRWSRHQSRLVRFLNRHydrophilic
NLS Segment(s)
PositionSequence
54-82GRPQRKRKGPRPLPQLPNIRPPPRRWSRH
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT135373  -  
Amino Acid Sequences MSIASAIREAAVFHTPIDTSPSSSGKECYIRADRSYPYGSRRFTISGQFGQNPGRPQRKRKGPRPLPQLPNIRPPPRRWSRHQSRLVRFLNRSFINSKLARKQLTRREQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.17
5 0.15
6 0.15
7 0.18
8 0.21
9 0.21
10 0.23
11 0.24
12 0.22
13 0.25
14 0.23
15 0.27
16 0.31
17 0.32
18 0.33
19 0.36
20 0.33
21 0.34
22 0.37
23 0.33
24 0.32
25 0.36
26 0.34
27 0.31
28 0.33
29 0.3
30 0.28
31 0.31
32 0.28
33 0.26
34 0.27
35 0.27
36 0.26
37 0.26
38 0.27
39 0.25
40 0.29
41 0.35
42 0.36
43 0.42
44 0.5
45 0.58
46 0.65
47 0.71
48 0.76
49 0.76
50 0.82
51 0.84
52 0.84
53 0.79
54 0.78
55 0.78
56 0.69
57 0.69
58 0.67
59 0.66
60 0.61
61 0.59
62 0.62
63 0.62
64 0.66
65 0.64
66 0.67
67 0.7
68 0.77
69 0.82
70 0.82
71 0.8
72 0.84
73 0.82
74 0.78
75 0.71
76 0.64
77 0.63
78 0.54
79 0.51
80 0.43
81 0.39
82 0.4
83 0.41
84 0.44
85 0.44
86 0.49
87 0.51
88 0.55
89 0.62
90 0.65