Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V081

Protein Details
Accession Q0V081    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
170-193ARATAAPKKQSRRSNPTPQPRASSHydrophilic
NLS Segment(s)
PositionSequence
172-208ATAAPKKQSRRSNPTPQPRASSAKPASRPSRAPRARR
Subcellular Location(s) nucl 17, mito 4, cyto 3, extr 3
Family & Domain DBs
KEGG pno:SNOG_02583  -  
Amino Acid Sequences MGYTNNWLSSDQILALRHLPVMPVTYRSLTKRRPLVTAASSTSSRVHRAFHEIPSYGPASCCARKEGRASTCIGEAKGVVVNSVCHMINSLAQIAGSQGPTAARPLYRRKIISADATCHRNITLHKDNSHKVIQDPLPSLPPATDPPATQAHTHPSPWVTEPRHSRSATARATAAPKKQSRRSNPTPQPRASSAKPASRPSRAPRARRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.16
6 0.15
7 0.13
8 0.15
9 0.15
10 0.16
11 0.18
12 0.2
13 0.24
14 0.29
15 0.36
16 0.4
17 0.47
18 0.52
19 0.52
20 0.53
21 0.52
22 0.53
23 0.49
24 0.47
25 0.41
26 0.36
27 0.34
28 0.32
29 0.33
30 0.28
31 0.28
32 0.24
33 0.24
34 0.22
35 0.31
36 0.32
37 0.33
38 0.35
39 0.31
40 0.3
41 0.31
42 0.3
43 0.22
44 0.19
45 0.17
46 0.18
47 0.2
48 0.21
49 0.22
50 0.24
51 0.28
52 0.33
53 0.39
54 0.37
55 0.36
56 0.37
57 0.34
58 0.35
59 0.32
60 0.27
61 0.19
62 0.15
63 0.14
64 0.13
65 0.12
66 0.08
67 0.07
68 0.07
69 0.08
70 0.1
71 0.08
72 0.06
73 0.07
74 0.08
75 0.08
76 0.09
77 0.09
78 0.07
79 0.06
80 0.07
81 0.06
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.07
90 0.07
91 0.11
92 0.18
93 0.23
94 0.28
95 0.28
96 0.29
97 0.32
98 0.33
99 0.37
100 0.32
101 0.3
102 0.29
103 0.31
104 0.3
105 0.26
106 0.24
107 0.19
108 0.18
109 0.23
110 0.29
111 0.3
112 0.34
113 0.38
114 0.4
115 0.42
116 0.43
117 0.36
118 0.27
119 0.3
120 0.28
121 0.27
122 0.28
123 0.24
124 0.24
125 0.23
126 0.22
127 0.16
128 0.15
129 0.14
130 0.16
131 0.16
132 0.14
133 0.17
134 0.22
135 0.23
136 0.22
137 0.22
138 0.25
139 0.26
140 0.26
141 0.25
142 0.22
143 0.22
144 0.24
145 0.3
146 0.27
147 0.33
148 0.4
149 0.45
150 0.51
151 0.49
152 0.49
153 0.48
154 0.53
155 0.49
156 0.44
157 0.38
158 0.34
159 0.4
160 0.43
161 0.43
162 0.43
163 0.47
164 0.53
165 0.61
166 0.68
167 0.71
168 0.76
169 0.79
170 0.81
171 0.84
172 0.87
173 0.87
174 0.82
175 0.78
176 0.74
177 0.72
178 0.64
179 0.64
180 0.6
181 0.6
182 0.62
183 0.64
184 0.66
185 0.65
186 0.7
187 0.68
188 0.72
189 0.72