Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XQP7

Protein Details
Accession K5XQP7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-51HDARKSCERCRAKARKRSHDKKRTLTAQLAHydrophilic
NLS Segment(s)
PositionSequence
33-43AKARKRSHDKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
KEGG abp:AGABI1DRAFT115350  -  
Amino Acid Sequences MENDDPTYKACSQCKRLDVPYHDARKSCERCRAKARKRSHDKKRTLTAQLASLNSTSSIQTQLKMPPPQTAKRKIEETRNTPRKVSKQSVPATANKAVSLQYQKAGSLYEAIKTATLSNSRCNFSGCHSIVYCDTIDHTKRAKMVTRDLLKIVKVSFKYDKPYKYNVTDTQVRVKYSCNCALSPPKTLSSTKSTNLQLETECGGTVAITVRDDGSHPLGIPGQQIVVEIAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.64
4 0.67
5 0.66
6 0.65
7 0.67
8 0.68
9 0.65
10 0.6
11 0.58
12 0.59
13 0.6
14 0.59
15 0.6
16 0.58
17 0.62
18 0.72
19 0.78
20 0.78
21 0.8
22 0.84
23 0.84
24 0.89
25 0.92
26 0.92
27 0.91
28 0.91
29 0.9
30 0.89
31 0.86
32 0.8
33 0.76
34 0.67
35 0.62
36 0.56
37 0.47
38 0.39
39 0.31
40 0.26
41 0.2
42 0.18
43 0.13
44 0.1
45 0.14
46 0.14
47 0.15
48 0.17
49 0.22
50 0.28
51 0.32
52 0.31
53 0.33
54 0.38
55 0.46
56 0.52
57 0.56
58 0.54
59 0.55
60 0.61
61 0.59
62 0.64
63 0.64
64 0.64
65 0.65
66 0.69
67 0.67
68 0.62
69 0.64
70 0.61
71 0.61
72 0.58
73 0.53
74 0.53
75 0.55
76 0.59
77 0.56
78 0.51
79 0.48
80 0.45
81 0.39
82 0.3
83 0.27
84 0.21
85 0.21
86 0.2
87 0.16
88 0.15
89 0.15
90 0.15
91 0.14
92 0.14
93 0.11
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.11
104 0.11
105 0.17
106 0.2
107 0.21
108 0.22
109 0.22
110 0.21
111 0.21
112 0.29
113 0.23
114 0.23
115 0.21
116 0.22
117 0.21
118 0.22
119 0.19
120 0.1
121 0.11
122 0.13
123 0.14
124 0.16
125 0.18
126 0.18
127 0.2
128 0.22
129 0.27
130 0.26
131 0.32
132 0.37
133 0.4
134 0.4
135 0.4
136 0.39
137 0.34
138 0.32
139 0.26
140 0.23
141 0.2
142 0.23
143 0.26
144 0.27
145 0.35
146 0.4
147 0.46
148 0.45
149 0.51
150 0.52
151 0.51
152 0.55
153 0.51
154 0.51
155 0.51
156 0.49
157 0.51
158 0.49
159 0.45
160 0.39
161 0.39
162 0.39
163 0.39
164 0.43
165 0.36
166 0.33
167 0.37
168 0.46
169 0.45
170 0.44
171 0.4
172 0.37
173 0.38
174 0.39
175 0.38
176 0.36
177 0.38
178 0.35
179 0.39
180 0.39
181 0.39
182 0.4
183 0.37
184 0.31
185 0.29
186 0.28
187 0.21
188 0.18
189 0.14
190 0.12
191 0.1
192 0.1
193 0.09
194 0.09
195 0.09
196 0.1
197 0.1
198 0.11
199 0.12
200 0.15
201 0.16
202 0.16
203 0.16
204 0.17
205 0.18
206 0.18
207 0.19
208 0.15
209 0.13
210 0.11
211 0.12