Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WT58

Protein Details
Accession K5WT58    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-28NHLDSNKGKKRREDKGNGKERLGBasic
NLS Segment(s)
PositionSequence
12-24KGKKRREDKGNGK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.333, mito 9, cyto 3
Family & Domain DBs
KEGG abp:AGABI1DRAFT133838  -  
Amino Acid Sequences MNLTPNHLDSNKGKKRREDKGNGKERLGEASSAAAPVLEPYQFIDEDGKLAYYYDLGKMVKEATMESAYDSTVNPFPEILLYPSTPPPPEGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.75
4 0.8
5 0.79
6 0.81
7 0.83
8 0.88
9 0.82
10 0.74
11 0.67
12 0.57
13 0.5
14 0.4
15 0.3
16 0.2
17 0.18
18 0.17
19 0.13
20 0.12
21 0.07
22 0.06
23 0.06
24 0.06
25 0.04
26 0.04
27 0.05
28 0.07
29 0.07
30 0.08
31 0.08
32 0.07
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.06
42 0.09
43 0.08
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.09
50 0.1
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.11
58 0.11
59 0.13
60 0.14
61 0.13
62 0.12
63 0.12
64 0.13
65 0.15
66 0.14
67 0.14
68 0.14
69 0.17
70 0.21
71 0.24
72 0.23