Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VPW1

Protein Details
Accession K5VPW1    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-130EEEKPKRKAATKKAAKKDEDBasic
139-161EEAEEKPKKKVTKKAAKKVDADEBasic
NLS Segment(s)
PositionSequence
112-127EEKPKRKAATKKAAKK
144-156KPKKKVTKKAAKK
170-179KPKKARTTKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, cyto_mito 6.833, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
KEGG abp:AGABI1DRAFT44775  -  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MSGYRLEYAPSARSKCKGPKPCAGTVIAKGDFRFGTLVEFKGNHNFSWRHWGCVTPKILDNVKKSIGEATEIDGYDELNDEDKAKVSAAWDEGHVADADIPDSARKPEGEEEEKPKRKAATKKAAKKDEDDDEEEDEEEEAEEKPKKKVTKKAAKKVDADEDGEGEVTEKPKKARTTKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.59
4 0.63
5 0.63
6 0.67
7 0.7
8 0.73
9 0.68
10 0.63
11 0.56
12 0.5
13 0.51
14 0.43
15 0.38
16 0.33
17 0.32
18 0.27
19 0.24
20 0.2
21 0.13
22 0.15
23 0.16
24 0.17
25 0.16
26 0.17
27 0.18
28 0.25
29 0.26
30 0.22
31 0.26
32 0.26
33 0.25
34 0.36
35 0.35
36 0.31
37 0.3
38 0.35
39 0.32
40 0.38
41 0.39
42 0.3
43 0.32
44 0.32
45 0.36
46 0.37
47 0.38
48 0.34
49 0.34
50 0.32
51 0.3
52 0.28
53 0.23
54 0.19
55 0.16
56 0.14
57 0.14
58 0.14
59 0.14
60 0.11
61 0.11
62 0.09
63 0.09
64 0.06
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.06
83 0.05
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.06
92 0.06
93 0.08
94 0.12
95 0.18
96 0.23
97 0.26
98 0.33
99 0.43
100 0.49
101 0.48
102 0.48
103 0.45
104 0.49
105 0.54
106 0.57
107 0.57
108 0.61
109 0.71
110 0.78
111 0.82
112 0.76
113 0.71
114 0.66
115 0.63
116 0.57
117 0.51
118 0.43
119 0.37
120 0.36
121 0.32
122 0.26
123 0.19
124 0.14
125 0.1
126 0.09
127 0.07
128 0.1
129 0.15
130 0.16
131 0.2
132 0.27
133 0.34
134 0.42
135 0.51
136 0.59
137 0.65
138 0.74
139 0.82
140 0.86
141 0.85
142 0.82
143 0.78
144 0.76
145 0.69
146 0.6
147 0.5
148 0.41
149 0.34
150 0.29
151 0.23
152 0.14
153 0.13
154 0.13
155 0.16
156 0.19
157 0.21
158 0.29
159 0.38
160 0.47