Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WGX5

Protein Details
Accession K5WGX5    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
214-233MTPRKSKKAKPAQPTPPPPPHydrophilic
277-302TTTPASKPSGRKRRARHTCHGASRRGHydrophilic
NLS Segment(s)
PositionSequence
217-227RKSKKAKPAQP
283-292KPSGRKRRAR
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
KEGG abp:AGABI1DRAFT133161  -  
Amino Acid Sequences MDIDADGDEGDWSDDEIPEGMYSSSVGRALLQAAARMEDELELPAASRLTTPTHSRQTGPVPAASSSLTPLSYASGYPGADKPSPEPFPSTLTPAPTSTPSTGRSRTLTAGQKGMLKLVNTSIVMLDDIEPKHPLYAPFTDCILRAAHVLIKRRDLDGYKTSFVAGIGSFSEQLAKIISSVDPPPRAFELTPPPPTPSGTATPRPRSPSADMDMTPRKSKKAKPAQPTPPPPPQPPIFGKDPVPSKNNTYAKAAARRPPQQQPPPRPQAPAAPAAVTTTPASKPSGRKRRARHTCHGASRRGVQLTPPAGSSIRASHISPAMLAEINKHLKDDVSSDIILEHSEDSGSGIFIAASRVPTHSETACVLKHIRRLVTVAGVVPIKSTPVTSTSYLKVIDVPMIPAEPKRVRQRALYFAGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.1
5 0.09
6 0.1
7 0.09
8 0.08
9 0.09
10 0.09
11 0.1
12 0.1
13 0.1
14 0.09
15 0.1
16 0.11
17 0.14
18 0.14
19 0.15
20 0.15
21 0.16
22 0.16
23 0.15
24 0.14
25 0.11
26 0.11
27 0.1
28 0.1
29 0.08
30 0.08
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.13
37 0.17
38 0.23
39 0.3
40 0.38
41 0.4
42 0.41
43 0.45
44 0.48
45 0.51
46 0.47
47 0.42
48 0.35
49 0.33
50 0.33
51 0.28
52 0.22
53 0.17
54 0.15
55 0.13
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.12
63 0.12
64 0.15
65 0.17
66 0.19
67 0.2
68 0.22
69 0.22
70 0.28
71 0.31
72 0.29
73 0.31
74 0.28
75 0.32
76 0.32
77 0.36
78 0.3
79 0.3
80 0.31
81 0.28
82 0.29
83 0.26
84 0.28
85 0.24
86 0.25
87 0.26
88 0.3
89 0.32
90 0.33
91 0.33
92 0.32
93 0.32
94 0.36
95 0.4
96 0.37
97 0.36
98 0.35
99 0.36
100 0.34
101 0.34
102 0.28
103 0.21
104 0.19
105 0.17
106 0.18
107 0.14
108 0.14
109 0.12
110 0.1
111 0.1
112 0.09
113 0.09
114 0.11
115 0.11
116 0.12
117 0.13
118 0.13
119 0.14
120 0.15
121 0.15
122 0.15
123 0.19
124 0.2
125 0.21
126 0.22
127 0.22
128 0.2
129 0.21
130 0.17
131 0.12
132 0.11
133 0.1
134 0.13
135 0.15
136 0.22
137 0.23
138 0.27
139 0.28
140 0.28
141 0.3
142 0.29
143 0.31
144 0.3
145 0.32
146 0.29
147 0.28
148 0.27
149 0.24
150 0.22
151 0.17
152 0.11
153 0.07
154 0.06
155 0.07
156 0.07
157 0.06
158 0.07
159 0.06
160 0.07
161 0.06
162 0.06
163 0.05
164 0.06
165 0.06
166 0.07
167 0.1
168 0.14
169 0.16
170 0.16
171 0.18
172 0.18
173 0.2
174 0.18
175 0.19
176 0.24
177 0.27
178 0.31
179 0.3
180 0.31
181 0.3
182 0.3
183 0.28
184 0.22
185 0.22
186 0.22
187 0.29
188 0.34
189 0.38
190 0.4
191 0.43
192 0.41
193 0.41
194 0.4
195 0.37
196 0.34
197 0.32
198 0.29
199 0.3
200 0.34
201 0.32
202 0.33
203 0.29
204 0.3
205 0.33
206 0.38
207 0.43
208 0.49
209 0.55
210 0.6
211 0.69
212 0.74
213 0.78
214 0.8
215 0.76
216 0.74
217 0.7
218 0.63
219 0.58
220 0.5
221 0.46
222 0.42
223 0.41
224 0.35
225 0.33
226 0.33
227 0.32
228 0.35
229 0.33
230 0.33
231 0.29
232 0.3
233 0.38
234 0.39
235 0.36
236 0.35
237 0.36
238 0.39
239 0.45
240 0.45
241 0.43
242 0.46
243 0.5
244 0.53
245 0.56
246 0.6
247 0.62
248 0.68
249 0.7
250 0.73
251 0.75
252 0.72
253 0.66
254 0.58
255 0.56
256 0.49
257 0.44
258 0.35
259 0.27
260 0.24
261 0.23
262 0.22
263 0.16
264 0.13
265 0.11
266 0.11
267 0.12
268 0.14
269 0.18
270 0.26
271 0.36
272 0.46
273 0.52
274 0.6
275 0.68
276 0.76
277 0.83
278 0.83
279 0.82
280 0.81
281 0.83
282 0.84
283 0.82
284 0.76
285 0.69
286 0.65
287 0.6
288 0.52
289 0.43
290 0.34
291 0.34
292 0.32
293 0.29
294 0.24
295 0.21
296 0.19
297 0.2
298 0.2
299 0.15
300 0.16
301 0.17
302 0.17
303 0.18
304 0.2
305 0.19
306 0.17
307 0.15
308 0.14
309 0.13
310 0.13
311 0.12
312 0.17
313 0.22
314 0.22
315 0.22
316 0.2
317 0.19
318 0.21
319 0.21
320 0.18
321 0.17
322 0.17
323 0.16
324 0.16
325 0.16
326 0.15
327 0.13
328 0.1
329 0.06
330 0.06
331 0.06
332 0.07
333 0.07
334 0.07
335 0.06
336 0.05
337 0.05
338 0.05
339 0.07
340 0.07
341 0.08
342 0.09
343 0.11
344 0.14
345 0.16
346 0.19
347 0.18
348 0.19
349 0.2
350 0.23
351 0.23
352 0.23
353 0.26
354 0.27
355 0.32
356 0.36
357 0.35
358 0.33
359 0.35
360 0.34
361 0.34
362 0.31
363 0.26
364 0.24
365 0.23
366 0.21
367 0.19
368 0.17
369 0.14
370 0.13
371 0.13
372 0.11
373 0.13
374 0.17
375 0.19
376 0.24
377 0.25
378 0.28
379 0.28
380 0.26
381 0.26
382 0.23
383 0.24
384 0.2
385 0.2
386 0.18
387 0.19
388 0.19
389 0.19
390 0.26
391 0.28
392 0.36
393 0.45
394 0.51
395 0.53
396 0.61
397 0.67
398 0.67