Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XB58

Protein Details
Accession K5XB58    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-116LKDHKQQQKDREKKVSKFEQBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
KEGG abp:AGABI1DRAFT84943  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSDREGHTGAPGDDDLSLPKATVSKMIAALLPNDIVCAKETRDLVIECCVEFIHLISSEANEICEQESKKTIAPEHIISALKRLGFDSFTSEVEDVLKDHKQQQKDREKKVSKFEQSGLTEEELLAEQEKLFAASRAKFQSTQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.1
6 0.11
7 0.12
8 0.12
9 0.15
10 0.15
11 0.15
12 0.16
13 0.16
14 0.17
15 0.16
16 0.17
17 0.14
18 0.13
19 0.1
20 0.1
21 0.09
22 0.08
23 0.09
24 0.1
25 0.1
26 0.13
27 0.14
28 0.14
29 0.17
30 0.17
31 0.17
32 0.2
33 0.19
34 0.15
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.1
52 0.1
53 0.11
54 0.13
55 0.13
56 0.15
57 0.16
58 0.17
59 0.16
60 0.18
61 0.18
62 0.17
63 0.19
64 0.18
65 0.16
66 0.18
67 0.16
68 0.14
69 0.13
70 0.12
71 0.1
72 0.1
73 0.11
74 0.13
75 0.14
76 0.14
77 0.15
78 0.15
79 0.14
80 0.14
81 0.13
82 0.09
83 0.1
84 0.12
85 0.12
86 0.19
87 0.25
88 0.31
89 0.38
90 0.48
91 0.56
92 0.64
93 0.71
94 0.75
95 0.78
96 0.77
97 0.8
98 0.8
99 0.75
100 0.71
101 0.65
102 0.63
103 0.56
104 0.53
105 0.46
106 0.37
107 0.3
108 0.25
109 0.23
110 0.15
111 0.13
112 0.11
113 0.09
114 0.07
115 0.08
116 0.08
117 0.09
118 0.09
119 0.11
120 0.16
121 0.18
122 0.25
123 0.29
124 0.33