Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WRF1

Protein Details
Accession K5WRF1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT28303  -  
abp:AGABI1DRAFT28322  -  
Pfam View protein in Pfam  
PF13650  Asp_protease_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.36
4 0.39
5 0.44
6 0.48
7 0.53
8 0.58
9 0.6
10 0.65
11 0.73
12 0.81
13 0.84
14 0.82
15 0.8
16 0.81
17 0.77
18 0.68
19 0.59
20 0.5
21 0.42
22 0.36
23 0.3
24 0.23
25 0.2
26 0.18
27 0.18
28 0.17
29 0.16
30 0.18
31 0.24
32 0.24
33 0.24
34 0.24
35 0.27
36 0.31
37 0.3
38 0.32
39 0.29
40 0.31
41 0.29
42 0.32
43 0.29
44 0.24
45 0.24
46 0.2
47 0.15
48 0.11
49 0.1
50 0.07
51 0.07
52 0.08
53 0.08