Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XU13

Protein Details
Accession K5XU13    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
12-35NEGLVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-22KKKIP
Subcellular Location(s) cyto 11, cyto_nucl 10.333, nucl 8.5, cyto_pero 6.333, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT25196  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCINEGLVKKKKIPTKKLERPITCRNSDGMIVGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNSEINWKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.4
4 0.44
5 0.5
6 0.56
7 0.6
8 0.66
9 0.67
10 0.7
11 0.77
12 0.82
13 0.86
14 0.84
15 0.82
16 0.83
17 0.79
18 0.7
19 0.61
20 0.52
21 0.43
22 0.37
23 0.3
24 0.24
25 0.19
26 0.18
27 0.17
28 0.16
29 0.16
30 0.16
31 0.2
32 0.17
33 0.18
34 0.17
35 0.2
36 0.23
37 0.22
38 0.25
39 0.23
40 0.24
41 0.23
42 0.25
43 0.23
44 0.19
45 0.18
46 0.15
47 0.12
48 0.08
49 0.08
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.08
60 0.07
61 0.08
62 0.09
63 0.11
64 0.1
65 0.13
66 0.13
67 0.16
68 0.18
69 0.18
70 0.19
71 0.19
72 0.19
73 0.23