Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VKD8

Protein Details
Accession K5VKD8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-32IDKGLVKKKKIPTKKLEQPITCHydrophilic
NLS Segment(s)
PositionSequence
18-20KKK
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT25327  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVNSGCTHTCIDKGLVKKKKIPTKKLEQPITCRNSDGTIAGKKDITRFMKMDLNINGHNKQLDVVATPLQSSDLFLGHDWLTNHNPEIDWKQGIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.49
4 0.55
5 0.62
6 0.69
7 0.74
8 0.76
9 0.75
10 0.77
11 0.82
12 0.84
13 0.84
14 0.79
15 0.76
16 0.76
17 0.72
18 0.62
19 0.52
20 0.43
21 0.35
22 0.31
23 0.25
24 0.19
25 0.18
26 0.18
27 0.18
28 0.19
29 0.18
30 0.19
31 0.24
32 0.23
33 0.22
34 0.22
35 0.24
36 0.27
37 0.27
38 0.3
39 0.25
40 0.26
41 0.26
42 0.28
43 0.27
44 0.23
45 0.23
46 0.18
47 0.16
48 0.13
49 0.11
50 0.08
51 0.09
52 0.1
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.07
61 0.08
62 0.08
63 0.11
64 0.1
65 0.13
66 0.13
67 0.17
68 0.19
69 0.2
70 0.21
71 0.2
72 0.2
73 0.22
74 0.26
75 0.26
76 0.25