Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5Y2D5

Protein Details
Accession K5Y2D5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-76ERTFRTSPRRKASSRRKKKADIGTGSDHydrophilic
NLS Segment(s)
PositionSequence
57-68PRRKASSRRKKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT112195  -  
Amino Acid Sequences MERARKRRKEIEDEIESCMEPVMDNEEEEGKRKRREWDPLPIETASEVDERTFRTSPRRKASSRRKKKADIGTGSDAMSITDGKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.59
3 0.49
4 0.39
5 0.3
6 0.2
7 0.11
8 0.09
9 0.1
10 0.09
11 0.09
12 0.1
13 0.14
14 0.14
15 0.18
16 0.24
17 0.25
18 0.29
19 0.32
20 0.39
21 0.41
22 0.51
23 0.52
24 0.57
25 0.56
26 0.54
27 0.54
28 0.46
29 0.4
30 0.3
31 0.25
32 0.15
33 0.11
34 0.09
35 0.06
36 0.07
37 0.09
38 0.13
39 0.14
40 0.14
41 0.24
42 0.32
43 0.41
44 0.49
45 0.55
46 0.56
47 0.66
48 0.77
49 0.78
50 0.81
51 0.82
52 0.82
53 0.83
54 0.87
55 0.86
56 0.85
57 0.81
58 0.77
59 0.72
60 0.65
61 0.57
62 0.48
63 0.37
64 0.27
65 0.21
66 0.14