Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XI93

Protein Details
Accession K5XI93    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-56APNAGKKRSSRSRWCRGVHRILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 7
Family & Domain DBs
KEGG abp:AGABI1DRAFT82844  -  
Amino Acid Sequences MTVNLKSSGIPASYDSTGAITVKFSESWSSSLTGAPNAGKKRSSRSRWCRGVHRIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.13
5 0.12
6 0.1
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.09
13 0.1
14 0.11
15 0.12
16 0.13
17 0.12
18 0.13
19 0.13
20 0.11
21 0.11
22 0.12
23 0.16
24 0.18
25 0.2
26 0.22
27 0.24
28 0.33
29 0.43
30 0.51
31 0.56
32 0.64
33 0.72
34 0.78
35 0.83
36 0.83