Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XGX1

Protein Details
Accession K5XGX1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT25559  -  
abp:AGABI1DRAFT27678  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEIDWKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.4
5 0.45
6 0.5
7 0.54
8 0.6
9 0.62
10 0.66
11 0.75
12 0.82
13 0.85
14 0.84
15 0.82
16 0.83
17 0.79
18 0.7
19 0.61
20 0.52
21 0.45
22 0.39
23 0.32
24 0.26
25 0.22
26 0.21
27 0.2
28 0.19
29 0.18
30 0.19
31 0.24
32 0.23
33 0.22
34 0.21
35 0.23
36 0.26
37 0.25
38 0.27
39 0.23
40 0.24
41 0.23
42 0.25
43 0.23
44 0.19
45 0.18
46 0.15
47 0.12
48 0.08
49 0.08
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.08
60 0.07
61 0.08
62 0.09
63 0.11
64 0.1
65 0.13
66 0.13
67 0.17
68 0.2
69 0.21
70 0.22
71 0.21
72 0.21
73 0.23