Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WJ77

Protein Details
Accession K5WJ77    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-87ESESKCKKTRSQSSGGRERAHydrophilic
NLS Segment(s)
PositionSequence
32-57RAVAGGRRRGRRETWAKRRACARGRK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
KEGG abp:AGABI1DRAFT116456  -  
Amino Acid Sequences MMERRLIWWASEGDVDKRWRSLVQASGKTEARAVAGGRRRGRRETWAKRRACARGRKLEERQAQAASESESKCKKTRSQSSGGRERA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.26
4 0.26
5 0.26
6 0.23
7 0.24
8 0.26
9 0.28
10 0.33
11 0.38
12 0.39
13 0.43
14 0.43
15 0.4
16 0.36
17 0.28
18 0.2
19 0.15
20 0.13
21 0.14
22 0.2
23 0.26
24 0.31
25 0.37
26 0.39
27 0.42
28 0.43
29 0.47
30 0.52
31 0.56
32 0.61
33 0.65
34 0.63
35 0.63
36 0.67
37 0.66
38 0.63
39 0.62
40 0.6
41 0.61
42 0.67
43 0.72
44 0.72
45 0.73
46 0.72
47 0.67
48 0.61
49 0.52
50 0.45
51 0.37
52 0.32
53 0.26
54 0.25
55 0.21
56 0.24
57 0.27
58 0.31
59 0.34
60 0.39
61 0.44
62 0.49
63 0.59
64 0.6
65 0.66
66 0.71
67 0.77