Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WBV6

Protein Details
Accession K5WBV6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KKMKLMKLMKKNQKSDREELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abp:AGABI1DRAFT82049  -  
Amino Acid Sequences KKMKLMKLMKKNQKSDREELMIVVLIRIPYVSMTASYRAAVKFLYPSNRLFASNSPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.74
4 0.67
5 0.58
6 0.49
7 0.4
8 0.31
9 0.24
10 0.18
11 0.12
12 0.07
13 0.07
14 0.06
15 0.05
16 0.04
17 0.04
18 0.05
19 0.05
20 0.06
21 0.08
22 0.09
23 0.1
24 0.12
25 0.11
26 0.12
27 0.11
28 0.1
29 0.13
30 0.16
31 0.23
32 0.23
33 0.25
34 0.29
35 0.3
36 0.31
37 0.29
38 0.29