Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WT76

Protein Details
Accession K5WT76    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-189FLSPVAKRKKPPQTPANKGPRQRVKRHydrophilic
NLS Segment(s)
PositionSequence
27-44ENKKTKEAREEAKAAKAK
144-188RVEHIARKSTKRGHEKDPNLFLSPVAKRKKPPQTPANKGPRQRVK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
KEGG abp:AGABI1DRAFT133822  -  
Amino Acid Sequences MPVQTRPKNKTTHPGLALRQLQLRREENKKTKEAREEAKAAKAKAHLRHIQEVSDLETSEAELYKSAANTTPNPSYPEIVPSTKKWQAAQKRTPKRSNAKSAAMSSEIDDSDVDEEPVRRKRSTQLRDAIEEMKVKSRDNGRQRVEHIARKSTKRGHEKDPNLFLSPVAKRKKPPQTPANKGPRQRVKRIVVVDTSDGEDETADEEYNDVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.65
4 0.64
5 0.56
6 0.55
7 0.49
8 0.47
9 0.47
10 0.5
11 0.48
12 0.51
13 0.59
14 0.62
15 0.67
16 0.71
17 0.71
18 0.72
19 0.75
20 0.74
21 0.7
22 0.68
23 0.67
24 0.61
25 0.62
26 0.59
27 0.5
28 0.46
29 0.46
30 0.45
31 0.45
32 0.51
33 0.48
34 0.48
35 0.56
36 0.53
37 0.48
38 0.43
39 0.37
40 0.32
41 0.27
42 0.22
43 0.14
44 0.13
45 0.12
46 0.11
47 0.1
48 0.07
49 0.06
50 0.07
51 0.08
52 0.08
53 0.08
54 0.1
55 0.12
56 0.14
57 0.19
58 0.21
59 0.21
60 0.25
61 0.25
62 0.24
63 0.22
64 0.24
65 0.22
66 0.22
67 0.23
68 0.23
69 0.29
70 0.31
71 0.32
72 0.31
73 0.36
74 0.44
75 0.51
76 0.58
77 0.61
78 0.68
79 0.75
80 0.78
81 0.78
82 0.78
83 0.76
84 0.77
85 0.71
86 0.66
87 0.6
88 0.55
89 0.48
90 0.39
91 0.31
92 0.22
93 0.18
94 0.13
95 0.1
96 0.09
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.07
103 0.11
104 0.18
105 0.21
106 0.2
107 0.21
108 0.3
109 0.4
110 0.45
111 0.49
112 0.5
113 0.5
114 0.52
115 0.53
116 0.47
117 0.38
118 0.35
119 0.27
120 0.26
121 0.24
122 0.22
123 0.24
124 0.29
125 0.36
126 0.42
127 0.51
128 0.48
129 0.52
130 0.54
131 0.6
132 0.59
133 0.57
134 0.52
135 0.52
136 0.54
137 0.53
138 0.58
139 0.55
140 0.59
141 0.62
142 0.63
143 0.64
144 0.69
145 0.72
146 0.74
147 0.73
148 0.67
149 0.6
150 0.55
151 0.45
152 0.41
153 0.39
154 0.39
155 0.39
156 0.39
157 0.42
158 0.52
159 0.63
160 0.65
161 0.7
162 0.72
163 0.76
164 0.82
165 0.87
166 0.88
167 0.84
168 0.81
169 0.82
170 0.83
171 0.8
172 0.79
173 0.79
174 0.74
175 0.74
176 0.73
177 0.67
178 0.61
179 0.56
180 0.5
181 0.41
182 0.37
183 0.29
184 0.24
185 0.19
186 0.15
187 0.11
188 0.11
189 0.1
190 0.08
191 0.07