Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5Y3J2

Protein Details
Accession K5Y3J2   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-115TTPSSSPQKKAPTPKRKREEQLKEECLPHydrophilic
NLS Segment(s)
PositionSequence
97-104KAPTPKRK
132-139VKRRRGAK
Subcellular Location(s) cyto 15, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR023170  HhH_base_excis_C  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006281  P:DNA repair  
KEGG abp:AGABI1DRAFT117974  -  
Amino Acid Sequences MGVGRKVADCILLMSLDKKEVVPVDTHVHQIAVKYYGMKRPGSGKMTMTPKLYEEVNTKLFSAWGDYAGWAHSVMFTADLKSFADHNTTPSSSPQKKAPTPKRKREEQLKEECLPTPPITPELEAGSLAERVKRRRGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.12
6 0.13
7 0.14
8 0.15
9 0.14
10 0.17
11 0.21
12 0.22
13 0.23
14 0.21
15 0.2
16 0.19
17 0.19
18 0.17
19 0.14
20 0.13
21 0.15
22 0.17
23 0.22
24 0.25
25 0.24
26 0.24
27 0.27
28 0.33
29 0.33
30 0.33
31 0.3
32 0.33
33 0.38
34 0.39
35 0.35
36 0.3
37 0.27
38 0.26
39 0.25
40 0.21
41 0.18
42 0.19
43 0.2
44 0.2
45 0.19
46 0.18
47 0.18
48 0.15
49 0.14
50 0.1
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.11
72 0.11
73 0.13
74 0.16
75 0.16
76 0.17
77 0.2
78 0.29
79 0.29
80 0.31
81 0.35
82 0.4
83 0.45
84 0.55
85 0.62
86 0.64
87 0.72
88 0.8
89 0.82
90 0.83
91 0.87
92 0.87
93 0.87
94 0.85
95 0.85
96 0.81
97 0.76
98 0.68
99 0.6
100 0.52
101 0.45
102 0.36
103 0.29
104 0.24
105 0.24
106 0.23
107 0.23
108 0.22
109 0.2
110 0.2
111 0.16
112 0.15
113 0.14
114 0.15
115 0.15
116 0.18
117 0.21
118 0.26
119 0.35