Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X2S9

Protein Details
Accession K5X2S9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
7-33AAPSGGKAAKKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
4-28AKAAAPSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG abp:AGABI1DRAFT112224  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPSGGKAAKKKKWSKGKVKDKAVHAVTLDKPTYDRILKEVPTFKFISQSILIERLKINGSLARVAIRHLKKENLIKPIVHHSAQLIYTRVTSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.55
4 0.62
5 0.67
6 0.74
7 0.81
8 0.85
9 0.86
10 0.9
11 0.9
12 0.91
13 0.87
14 0.8
15 0.79
16 0.69
17 0.6
18 0.49
19 0.44
20 0.36
21 0.34
22 0.29
23 0.21
24 0.2
25 0.19
26 0.22
27 0.19
28 0.17
29 0.16
30 0.19
31 0.21
32 0.24
33 0.29
34 0.25
35 0.28
36 0.28
37 0.25
38 0.25
39 0.23
40 0.23
41 0.17
42 0.18
43 0.15
44 0.19
45 0.19
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.14
52 0.11
53 0.12
54 0.12
55 0.13
56 0.13
57 0.12
58 0.14
59 0.22
60 0.22
61 0.26
62 0.29
63 0.32
64 0.37
65 0.46
66 0.5
67 0.48
68 0.49
69 0.44
70 0.44
71 0.49
72 0.48
73 0.39
74 0.34
75 0.29
76 0.3
77 0.31
78 0.3
79 0.23
80 0.19
81 0.2