Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WF48

Protein Details
Accession K5WF48   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
204-232PETGSRPASKPPPKKVKFNPPSPPARRASHydrophilic
NLS Segment(s)
PositionSequence
207-231GSRPASKPPPKKVKFNPPSPPARRA
Subcellular Location(s) nucl 16.5, cyto_nucl 10.333, mito 4.5, cyto_mito 4.333, cyto 3
Family & Domain DBs
KEGG abp:AGABI1DRAFT133907  -  
Amino Acid Sequences MPPKPKCPKAKSDAVVPAWADHVNLDELNENQRQFLFANSGSAPAILATLQHKGTITSWNPPRGGPLDVRPFGPDSIIPAPNMDWDADGGDLFDLPGSGTQTTSTLAKAGDDQDMRSPESPTPTSAPFWGVYFRNLENALATLDPTHHQSARYLSTMLTGLQKIVRDERYLSLQVDGGFTVANLIDALPHRSSAAQPPHPPRVPETGSRPASKPPPKKVKFNPPSPPARRASAPSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.52
4 0.45
5 0.36
6 0.33
7 0.24
8 0.15
9 0.14
10 0.12
11 0.12
12 0.12
13 0.12
14 0.13
15 0.17
16 0.21
17 0.19
18 0.18
19 0.18
20 0.19
21 0.17
22 0.18
23 0.17
24 0.14
25 0.17
26 0.17
27 0.18
28 0.16
29 0.16
30 0.14
31 0.09
32 0.09
33 0.05
34 0.07
35 0.07
36 0.1
37 0.1
38 0.11
39 0.11
40 0.12
41 0.14
42 0.2
43 0.2
44 0.26
45 0.32
46 0.36
47 0.37
48 0.35
49 0.38
50 0.33
51 0.34
52 0.27
53 0.29
54 0.33
55 0.33
56 0.34
57 0.31
58 0.31
59 0.28
60 0.26
61 0.18
62 0.15
63 0.18
64 0.19
65 0.17
66 0.16
67 0.16
68 0.16
69 0.17
70 0.12
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.11
98 0.11
99 0.11
100 0.14
101 0.15
102 0.16
103 0.16
104 0.16
105 0.14
106 0.17
107 0.17
108 0.16
109 0.17
110 0.17
111 0.17
112 0.16
113 0.16
114 0.13
115 0.13
116 0.14
117 0.13
118 0.13
119 0.14
120 0.14
121 0.15
122 0.15
123 0.14
124 0.11
125 0.11
126 0.1
127 0.08
128 0.08
129 0.05
130 0.06
131 0.07
132 0.1
133 0.12
134 0.12
135 0.12
136 0.14
137 0.17
138 0.19
139 0.2
140 0.17
141 0.15
142 0.15
143 0.15
144 0.15
145 0.14
146 0.11
147 0.11
148 0.12
149 0.13
150 0.14
151 0.18
152 0.19
153 0.18
154 0.2
155 0.21
156 0.24
157 0.25
158 0.24
159 0.2
160 0.2
161 0.19
162 0.17
163 0.15
164 0.1
165 0.08
166 0.07
167 0.07
168 0.05
169 0.05
170 0.04
171 0.04
172 0.06
173 0.07
174 0.11
175 0.11
176 0.11
177 0.12
178 0.13
179 0.15
180 0.22
181 0.3
182 0.33
183 0.41
184 0.48
185 0.57
186 0.59
187 0.59
188 0.54
189 0.54
190 0.51
191 0.5
192 0.5
193 0.5
194 0.52
195 0.54
196 0.52
197 0.5
198 0.56
199 0.6
200 0.62
201 0.63
202 0.69
203 0.71
204 0.8
205 0.83
206 0.85
207 0.84
208 0.85
209 0.84
210 0.82
211 0.87
212 0.83
213 0.81
214 0.74
215 0.69
216 0.63
217 0.6