Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WE14

Protein Details
Accession K5WE14    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPRRCRKRRNAKKRAQERSRLSGTBasic
NLS Segment(s)
PositionSequence
4-20RCRKRRNAKKRAQERSR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG abp:AGABI1DRAFT134663  -  
Amino Acid Sequences MPRRCRKRRNAKKRAQERSRLSGTSKSNVKGPFGHLSGIGAALPAVKTPPTPPGDVPTGSGSPGSDIPLRASALGAYSSPSSSPSSHCEPPSCEKGGRNTGTKSCQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.93
3 0.92
4 0.88
5 0.85
6 0.8
7 0.71
8 0.63
9 0.6
10 0.54
11 0.51
12 0.48
13 0.41
14 0.41
15 0.4
16 0.39
17 0.33
18 0.34
19 0.31
20 0.27
21 0.27
22 0.21
23 0.2
24 0.18
25 0.16
26 0.11
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.06
36 0.12
37 0.14
38 0.15
39 0.16
40 0.18
41 0.21
42 0.21
43 0.21
44 0.18
45 0.16
46 0.14
47 0.14
48 0.11
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.1
55 0.12
56 0.12
57 0.11
58 0.11
59 0.09
60 0.09
61 0.09
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.1
68 0.12
69 0.12
70 0.15
71 0.19
72 0.25
73 0.3
74 0.32
75 0.34
76 0.37
77 0.43
78 0.46
79 0.45
80 0.42
81 0.41
82 0.46
83 0.52
84 0.52
85 0.51
86 0.51
87 0.53