Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XBZ0

Protein Details
Accession K5XBZ0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-62QTKSSRASPLKQRCKRKTVSKPPGPGTIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT112355  -  
Amino Acid Sequences MTTACTQNERQKYAQELAAHTLRQFTAACHSTDQTKSSRASPLKQRCKRKTVSKPPGPGTIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.34
4 0.34
5 0.34
6 0.3
7 0.25
8 0.23
9 0.18
10 0.17
11 0.15
12 0.11
13 0.15
14 0.16
15 0.17
16 0.16
17 0.17
18 0.18
19 0.19
20 0.21
21 0.16
22 0.18
23 0.19
24 0.2
25 0.27
26 0.27
27 0.32
28 0.41
29 0.5
30 0.58
31 0.65
32 0.74
33 0.74
34 0.8
35 0.83
36 0.83
37 0.84
38 0.84
39 0.87
40 0.85
41 0.86
42 0.82
43 0.82