Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VVA5

Protein Details
Accession K5VVA5   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-35VGDERYTRKTRKKGLRGSPAMRBasic
NLS Segment(s)
PositionSequence
21-30RKTRKKGLRG
Subcellular Location(s) nucl 19.5, mito_nucl 13.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT114695  -  
Amino Acid Sequences MEIRAPRWWNLSRVGDERYTRKTRKKGLRGSPAMRSHLNRFHSHHHPMRRLIDSMRPRAMISSTESPYRPNYVVLTEARPTWCLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.44
4 0.46
5 0.47
6 0.5
7 0.52
8 0.57
9 0.62
10 0.67
11 0.73
12 0.78
13 0.8
14 0.81
15 0.85
16 0.84
17 0.79
18 0.77
19 0.71
20 0.64
21 0.58
22 0.5
23 0.45
24 0.43
25 0.43
26 0.37
27 0.36
28 0.38
29 0.41
30 0.45
31 0.46
32 0.47
33 0.48
34 0.49
35 0.5
36 0.46
37 0.42
38 0.37
39 0.39
40 0.39
41 0.4
42 0.38
43 0.34
44 0.32
45 0.31
46 0.3
47 0.23
48 0.23
49 0.24
50 0.23
51 0.26
52 0.26
53 0.27
54 0.29
55 0.32
56 0.27
57 0.22
58 0.22
59 0.21
60 0.25
61 0.25
62 0.26
63 0.24
64 0.26
65 0.25
66 0.25