Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WF79

Protein Details
Accession K5WF79    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26DEELVKKKKIPTKKLERPITCRNSDHydrophilic
NLS Segment(s)
PositionSequence
8-11KKKI
Subcellular Location(s) nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT27255  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
Amino Acid Sequences IDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEIDWKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.87
5 0.84
6 0.85
7 0.82
8 0.73
9 0.64
10 0.56
11 0.48
12 0.41
13 0.35
14 0.29
15 0.26
16 0.24
17 0.23
18 0.22
19 0.2
20 0.21
21 0.27
22 0.25
23 0.24
24 0.23
25 0.25
26 0.28
27 0.27
28 0.28
29 0.24
30 0.24
31 0.22
32 0.24
33 0.22
34 0.18
35 0.17
36 0.14
37 0.11
38 0.08
39 0.07
40 0.05
41 0.05
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.11
54 0.1
55 0.13
56 0.13
57 0.17
58 0.19
59 0.21
60 0.22
61 0.2
62 0.21
63 0.23