Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UFN8

Protein Details
Accession Q0UFN8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
5-33TNNPQGKRKSSSKPQGPKRKEKLPTTFQCHydrophilic
NLS Segment(s)
PositionSequence
11-26KRKSSSKPQGPKRKEK
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG pno:SNOG_09426  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MRILTNNPQGKRKSSSKPQGPKRKEKLPTTFQCLFCNHEKSVSVSIEKKSGVGNLQCKVCGQTFQTNINYLSAPVDVYADWIDACDAVAKEAAAGKTATTRATGRMGRVETAREEDEDDVPDADDLRFVEQDDLDAEGEYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.73
4 0.8
5 0.85
6 0.89
7 0.9
8 0.91
9 0.88
10 0.87
11 0.85
12 0.84
13 0.82
14 0.81
15 0.79
16 0.76
17 0.76
18 0.68
19 0.63
20 0.56
21 0.51
22 0.46
23 0.44
24 0.36
25 0.31
26 0.3
27 0.29
28 0.32
29 0.29
30 0.27
31 0.25
32 0.26
33 0.26
34 0.25
35 0.22
36 0.18
37 0.17
38 0.18
39 0.19
40 0.23
41 0.23
42 0.24
43 0.24
44 0.23
45 0.24
46 0.2
47 0.18
48 0.16
49 0.19
50 0.21
51 0.25
52 0.26
53 0.26
54 0.26
55 0.25
56 0.21
57 0.15
58 0.13
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.06
78 0.09
79 0.09
80 0.08
81 0.08
82 0.08
83 0.1
84 0.11
85 0.11
86 0.11
87 0.12
88 0.13
89 0.19
90 0.21
91 0.2
92 0.25
93 0.26
94 0.26
95 0.26
96 0.26
97 0.23
98 0.26
99 0.25
100 0.2
101 0.21
102 0.2
103 0.2
104 0.2
105 0.19
106 0.15
107 0.14
108 0.13
109 0.12
110 0.1
111 0.1
112 0.09
113 0.11
114 0.11
115 0.11
116 0.14
117 0.12
118 0.13
119 0.13
120 0.14
121 0.12
122 0.12