Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XFR2

Protein Details
Accession K5XFR2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) cyto 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT135362  -  
Pfam View protein in Pfam  
PF13650  Asp_protease_2  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVAMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.36
4 0.38
5 0.43
6 0.48
7 0.52
8 0.58
9 0.6
10 0.64
11 0.73
12 0.8
13 0.84
14 0.82
15 0.8
16 0.81
17 0.77
18 0.67
19 0.58
20 0.49
21 0.41
22 0.36
23 0.29
24 0.23
25 0.2
26 0.19
27 0.18
28 0.18
29 0.17
30 0.19
31 0.26
32 0.25
33 0.25
34 0.25
35 0.28
36 0.32
37 0.32
38 0.34
39 0.31
40 0.33
41 0.31
42 0.34
43 0.31
44 0.26
45 0.25
46 0.21
47 0.16
48 0.12
49 0.1