Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R5V7

Protein Details
Accession C4R5V7   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
115-147YMTLNQKRTRGKPAPKRKTRRNNKRTSYANVVFHydrophilic
NLS Segment(s)
PositionSequence
121-139KRTRGKPAPKRKTRRNNKR
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
KEGG ppa:PAS_chr3_0886  -  
Amino Acid Sequences MERSLSWHKAIVKSLIDDWTTKSTEDSYLKAFYANYNFLDDYSSLDLNFSYGKSSSGEEDQSHAHNTRPENAGINRPGEIPGVTNDDNDDNESVVSQALSSNDSLVNVNLYRFHYMTLNQKRTRGKPAPKRKTRRNNKRTSYANVVFRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.27
5 0.27
6 0.27
7 0.25
8 0.23
9 0.21
10 0.19
11 0.24
12 0.25
13 0.24
14 0.22
15 0.23
16 0.23
17 0.23
18 0.21
19 0.19
20 0.21
21 0.21
22 0.19
23 0.2
24 0.2
25 0.19
26 0.21
27 0.17
28 0.16
29 0.16
30 0.15
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.08
37 0.07
38 0.07
39 0.08
40 0.09
41 0.1
42 0.11
43 0.12
44 0.14
45 0.13
46 0.14
47 0.15
48 0.15
49 0.17
50 0.16
51 0.15
52 0.17
53 0.17
54 0.2
55 0.21
56 0.2
57 0.21
58 0.22
59 0.26
60 0.24
61 0.24
62 0.2
63 0.18
64 0.18
65 0.14
66 0.13
67 0.09
68 0.08
69 0.13
70 0.12
71 0.12
72 0.12
73 0.13
74 0.13
75 0.13
76 0.12
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.1
94 0.09
95 0.09
96 0.11
97 0.13
98 0.15
99 0.15
100 0.16
101 0.15
102 0.18
103 0.29
104 0.37
105 0.44
106 0.44
107 0.51
108 0.57
109 0.6
110 0.67
111 0.67
112 0.67
113 0.69
114 0.77
115 0.82
116 0.85
117 0.92
118 0.92
119 0.94
120 0.95
121 0.95
122 0.95
123 0.94
124 0.93
125 0.92
126 0.88
127 0.85
128 0.83
129 0.8
130 0.76