Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XHK0

Protein Details
Accession K5XHK0    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-76ENPPVKRGRGRPKGSKNKKTVABasic
82-122SSTPVVPRKRGRPPKPRPEQGEPTQKRPRGRPRKNPAPDGABasic
NLS Segment(s)
PositionSequence
59-117VKRGRGRPKGSKNKKTVAAGAGASSTPVVPRKRGRPPKPRPEQGEPTQKRPRGRPRKNP
139-150AKKKPGRPKKTA
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG abp:AGABI1DRAFT111335  -  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences PRLLRTPKRKSTSDSLSTSWRSSNKTPTTNQVSKVIPESVSNLEISCDGTTDAAENPPVKRGRGRPKGSKNKKTVAAGAGASSTPVVPRKRGRPPKPRPEQGEPTQKRPRGRPRKNPAPDGAGADADTGSGETGGESSAKKKPGRPKKTAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.58
4 0.57
5 0.51
6 0.47
7 0.41
8 0.39
9 0.39
10 0.46
11 0.47
12 0.5
13 0.51
14 0.55
15 0.61
16 0.59
17 0.57
18 0.53
19 0.47
20 0.42
21 0.42
22 0.35
23 0.26
24 0.23
25 0.23
26 0.19
27 0.19
28 0.17
29 0.14
30 0.13
31 0.12
32 0.13
33 0.09
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.09
42 0.1
43 0.1
44 0.16
45 0.17
46 0.17
47 0.22
48 0.3
49 0.39
50 0.48
51 0.55
52 0.59
53 0.69
54 0.79
55 0.85
56 0.85
57 0.8
58 0.76
59 0.74
60 0.65
61 0.57
62 0.47
63 0.38
64 0.29
65 0.23
66 0.17
67 0.12
68 0.1
69 0.07
70 0.06
71 0.05
72 0.11
73 0.12
74 0.16
75 0.21
76 0.29
77 0.4
78 0.51
79 0.6
80 0.66
81 0.75
82 0.82
83 0.87
84 0.88
85 0.85
86 0.83
87 0.81
88 0.78
89 0.79
90 0.72
91 0.7
92 0.71
93 0.68
94 0.65
95 0.66
96 0.69
97 0.69
98 0.76
99 0.78
100 0.8
101 0.86
102 0.89
103 0.86
104 0.8
105 0.74
106 0.65
107 0.58
108 0.49
109 0.38
110 0.31
111 0.24
112 0.19
113 0.13
114 0.11
115 0.07
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.06
123 0.07
124 0.11
125 0.16
126 0.23
127 0.27
128 0.34
129 0.45
130 0.55
131 0.64