Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XDZ2

Protein Details
Accession K5XDZ2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-122KRDGSHLRRQKRKRSEMQEGRRDTBasic
NLS Segment(s)
PositionSequence
94-113KTKPEKRDGSHLRRQKRKRS
Subcellular Location(s) mito 11, nucl 8, cyto 7
Family & Domain DBs
KEGG abp:AGABI1DRAFT125787  -  
Amino Acid Sequences MPPTYALSKTRNGREYAGCADYPRFPQEELERLVSRAVELETAAEDPPPHEGQASSGKKRARSPTPLEIECPDGPAAVDPSPAGVPPPPDVPLKTKPEKRDGSHLRRQKRKRSEMQEGRRDTLHQGPNHWVLRAGRHWPAPALGCTGVPGYGVHGRPLERGGGTAPPSGIIGSTWSQVPWHRLFAFAACD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.49
4 0.45
5 0.37
6 0.34
7 0.34
8 0.32
9 0.31
10 0.3
11 0.26
12 0.23
13 0.28
14 0.31
15 0.35
16 0.35
17 0.37
18 0.34
19 0.33
20 0.33
21 0.28
22 0.23
23 0.18
24 0.15
25 0.09
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.12
35 0.12
36 0.11
37 0.11
38 0.11
39 0.14
40 0.24
41 0.3
42 0.29
43 0.33
44 0.36
45 0.39
46 0.46
47 0.5
48 0.47
49 0.49
50 0.53
51 0.57
52 0.61
53 0.58
54 0.54
55 0.47
56 0.45
57 0.37
58 0.31
59 0.22
60 0.15
61 0.14
62 0.12
63 0.13
64 0.08
65 0.08
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.07
73 0.08
74 0.09
75 0.1
76 0.11
77 0.13
78 0.17
79 0.23
80 0.29
81 0.35
82 0.39
83 0.41
84 0.48
85 0.53
86 0.5
87 0.54
88 0.57
89 0.58
90 0.62
91 0.66
92 0.66
93 0.71
94 0.77
95 0.77
96 0.77
97 0.78
98 0.79
99 0.81
100 0.83
101 0.84
102 0.85
103 0.84
104 0.77
105 0.69
106 0.6
107 0.53
108 0.44
109 0.42
110 0.39
111 0.3
112 0.29
113 0.32
114 0.39
115 0.38
116 0.35
117 0.3
118 0.24
119 0.28
120 0.3
121 0.29
122 0.26
123 0.27
124 0.28
125 0.26
126 0.27
127 0.24
128 0.22
129 0.21
130 0.17
131 0.15
132 0.15
133 0.15
134 0.12
135 0.1
136 0.09
137 0.1
138 0.15
139 0.15
140 0.17
141 0.18
142 0.19
143 0.2
144 0.22
145 0.2
146 0.15
147 0.15
148 0.15
149 0.17
150 0.19
151 0.19
152 0.18
153 0.16
154 0.16
155 0.15
156 0.14
157 0.09
158 0.1
159 0.1
160 0.12
161 0.12
162 0.12
163 0.14
164 0.18
165 0.24
166 0.24
167 0.29
168 0.28
169 0.3
170 0.31