Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W875

Protein Details
Accession K5W875   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-67VTPNPTSRRRSKPPSFALRRRRLASHydrophilic
NLS Segment(s)
PositionSequence
50-64RRRSKPPSFALRRRR
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
KEGG abp:AGABI1DRAFT125537  -  
Amino Acid Sequences MPSLPLLPPLELASPSPVRRPKSQPLPLLTHSPAPALSKSVCVTPNPTSRRRSKPPSFALRRRRLASRVEYAPERLPIHPFDKLPWIASMDLPTDNVRPNDLADLSLIPDDPFISCPTTGTGPIRHRKLTSRRSPLTLETHAERGDDSLFHYASNLFPRTVPERPSTPMNMSRLDPAHITFRHLMPVIDDGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.32
4 0.37
5 0.4
6 0.47
7 0.53
8 0.57
9 0.63
10 0.7
11 0.69
12 0.69
13 0.71
14 0.66
15 0.65
16 0.56
17 0.49
18 0.41
19 0.35
20 0.3
21 0.25
22 0.23
23 0.19
24 0.18
25 0.17
26 0.18
27 0.2
28 0.21
29 0.19
30 0.23
31 0.27
32 0.36
33 0.39
34 0.44
35 0.48
36 0.55
37 0.63
38 0.67
39 0.7
40 0.7
41 0.74
42 0.77
43 0.81
44 0.83
45 0.83
46 0.85
47 0.84
48 0.82
49 0.76
50 0.71
51 0.64
52 0.61
53 0.57
54 0.53
55 0.46
56 0.43
57 0.4
58 0.38
59 0.36
60 0.33
61 0.29
62 0.23
63 0.22
64 0.22
65 0.23
66 0.23
67 0.22
68 0.19
69 0.22
70 0.22
71 0.21
72 0.18
73 0.18
74 0.15
75 0.15
76 0.15
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.12
83 0.12
84 0.11
85 0.1
86 0.1
87 0.11
88 0.1
89 0.09
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.08
102 0.08
103 0.08
104 0.1
105 0.11
106 0.12
107 0.13
108 0.19
109 0.25
110 0.33
111 0.36
112 0.37
113 0.38
114 0.45
115 0.53
116 0.57
117 0.6
118 0.62
119 0.61
120 0.63
121 0.64
122 0.6
123 0.56
124 0.49
125 0.42
126 0.34
127 0.34
128 0.31
129 0.28
130 0.23
131 0.18
132 0.15
133 0.12
134 0.12
135 0.13
136 0.12
137 0.12
138 0.13
139 0.12
140 0.14
141 0.19
142 0.19
143 0.16
144 0.16
145 0.21
146 0.26
147 0.3
148 0.31
149 0.3
150 0.32
151 0.35
152 0.4
153 0.4
154 0.41
155 0.43
156 0.42
157 0.41
158 0.39
159 0.41
160 0.37
161 0.35
162 0.3
163 0.26
164 0.3
165 0.28
166 0.32
167 0.3
168 0.29
169 0.32
170 0.32
171 0.3
172 0.23